KEGG   Chondrus crispus (carragheen): CHC_60
Entry
CHC_60            CDS       T02916                                 

Gene name
psbV
Definition
(RefSeq) cytochrome c550
  KO
K02720  photosystem II cytochrome c550
Organism
ccp  Chondrus crispus (carragheen)
Pathway
ccp00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:ccp00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    CHC_60 (psbV)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:ccp00194]
    CHC_60 (psbV)
Photosynthesis proteins [BR:ccp00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other subunits in cyanobacteria
    CHC_60 (psbV)
SSDB
Motif
Pfam: Cytochrom_C550 Cytochrom_C Cytochrome_CBB3 Cytochrom_C1 PSCyt3 DUF2428
Other DBs
NCBI-GeneID: 14971012
NCBI-ProteinID: YP_007627300
UniProt: M5DBK0
Position
PT
AA seq 163 aa
MLINNIWRSFAITSLIFGILLKPVQAIELDEITRTVQLEESGKTIILTREQVKRGKRLFN
NSCAQCHNGGITKTNPNIGLELESLSLATPARDNISSLINYMKDPTSYDGATSIAELHPS
IKSAEIFPKMRNLTDDDLFAIAGHILIQPKIVAEKWGGGKIYY
NT seq 492 nt   +upstreamnt  +downstreamnt
atgctaatcaacaatatttggcgatcttttgctatcacaagtttaatatttggaatatta
ttaaaacctgtacaagctatagaattagatgaaattacaagaacagtacaattagaagaa
tctggaaaaaccattatattaacacgagaacaagtcaaaagaggaaaaagattatttaat
aattcatgtgcacaatgccataatggaggtattactaaaactaaccctaatattggtcta
gaattagaatctctaagcttagctacaccagcacgtgataatatcagttcattaattaac
tacatgaaagacccaactagctatgatggtgcaacatctattgcagaattacatccaagc
attaaaagtgcagaaatttttccaaaaatgcgtaacttaactgatgatgatctatttgca
attgcaggacatatattaatacaacctaagatagtagctgaaaaatggggagggggaaaa
atttactactaa

DBGET integrated database retrieval system