KEGG   Chondrus crispus (carragheen): CHC_T00003466001
Entry
CHC_T00003466001  CDS       T02916                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
ccp00100  Steroid biosynthesis
ccp01100  Metabolic pathways
ccp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CHC_T00003466001
Enzymes [BR:ccp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CHC_T00003466001
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 DUF5392
Other DBs
NCBI-GeneID: 17322939
NCBI-ProteinID: XP_005715240
UniProt: R7QDA0
AA seq 388 aa
MKWAHGYLLLCSATFAVLFRDLLPLLPYARLPVPTVPVVLAFLGYVATLAVLGAFLPGKT
YAGAVLPDGSRLTYKCNGLQVVGVVVTALAVAHWSAYWRATWVVHHYAQLLLVANAFALA
LSVYLCVAGRLRRPRNWLRSTSLLADFVMGAELNPTVLAIDVKFFSYRPAMAGWLIVNLS
FLAKQLDHLGFITSRMLLYQLVTAWYIWDYFVHEPKIVSTWDIIAEHFGLMLVWGDYVFI
VFAFSVQNFFLLDDTRPLSYLEVALIAITFSLGFAVFRGANSQKHQFKTQPKTHIWGKPP
ITVGDRLLASGFWGIARHMNYTGDLMLALSFSLPCGRASPLAYFYFFYLLLLTVHREMRD
DQRCSRKYKSLWDEYCLQVPYRMVPFVY
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgaagtgggcgcacggctacctgctgctgtgcagcgccaccttcgccgtgctgttccgc
gaccttctccctctcctgccctacgcccgtctgccggtccccacggtgcccgtcgtcctg
gccttcctgggctacgtcgccacgctagccgtgctgggcgccttcctgccgggcaagacc
tacgccggcgccgtcctgcccgacggctcgcgcctcacctacaagtgtaacggcctccag
gtcgtgggcgtcgtcgtcacggccctggccgtcgcgcattggagcgcctactggcgcgcc
acctgggtcgtccaccactacgcacagctgctgctcgtcgccaacgcattcgccctcgcc
ctctccgtctacctctgcgtcgcaggccgccttcgcaggcccaggaactggctccgctcc
acctccctcctcgctgacttcgtcatgggcgcggagctcaaccccaccgtccttgccatc
gacgtcaagttcttctcgtatcgccccgccatggctggttggctcatcgtcaatttgtcc
tttttggcaaagcagctcgaccacctcggcttcatcaccagcaggatgctgctgtaccag
ctcgtcaccgcctggtacatctgggattactttgtgcacgagccgaagatcgtgtcgacg
tgggacattatcgccgagcactttggcctcatgctggtgtggggcgactacgtcttcatc
gtctttgccttcagcgtgcagaacttcttcctgcttgacgacacccgtccgctctcctac
cttgaggtcgcgctaatcgccatcaccttcagtctgggctttgccgttttccgcggcgcc
aattcccaaaaacaccagttcaagacccagcccaagacccacatctgggggaagccgcct
atcaccgtcggcgacaggctgcttgcgtccggcttttggggcatagcacgacacatgaat
tacacgggcgatctcatgcttgccctctccttttcacttccctgtggacgcgcctccccg
ttggcctacttttactttttctaccttcttttgctcaccgtgcaccgcgaaatgagagac
gatcagcgctgctcgcgcaagtacaagtcgctctgggatgaatattgcttgcaagtgccg
taccgcatggtgccttttgtatattag

DBGET integrated database retrieval system