KEGG   Chondrus crispus (carragheen): CHC_T00004119001Help
Entry
CHC_T00004119001  CDS       T02916                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
ccp00010  Glycolysis / Gluconeogenesis
ccp00562  Inositol phosphate metabolism
ccp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHC_T00004119001
   00562 Inositol phosphate metabolism
    CHC_T00004119001
Enzymes [BR:ccp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     CHC_T00004119001
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     CHC_T00004119001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 17323132
NCBI-ProteinID: XP_005715416
UniProt: R7QAQ7
AA seq 735 aa AA seqDB search
MCVSNSRFSSCLLDRSVPLPLLPAPPSSKSERNRANDSQATKPRPLPHRLILPILILSAD
HPPTLPTPPPCPHLNLSMSLIPTPLPPSLQLTLGPIHTSHHVFTNSAVSSLPLPPPSSLS
YKTVRHATHLQQCPRQPPHNHSILSLLHNQTLSPFPFPSVPAHSHTSPSIRPPSLQLFPL
QLTASPPKTPSNTHLSLPIIKSTTNTIPVMLHQPQPLQVLPHAPLADSPASTLPHLHRLR
VLTTPALRETNSLTIATPPNRRTLAEWSYGTKTPYLPPRLIQHIVTCPRSDHPAAAARLI
HVSLIARHGTRNPTKTSLQRMLSLYSWLRAALPSPQPLWLDRWEQTLKVYSQNPGDLTIH
GEHELCNIGMRFAHIYGQTLHETTNKFRIRSSYKNRAIQSAKAFRMGYVQACQQLGIPLP
DTHEFEQESDSDSEPGTTTPSVHSCPSTSALPRSSDGDDRVEVLPIGRDASLRYFDPHHH
NEYATFATRYKTEQRQNFSQSLVRHIAAEMANRISTTLGATIPLELDLVRVIGEVCAFET
AHGRAGTSPFFRLLTPGDTRVLELADIRNRPFFKAHERFRAAAAPLVQDIMDSLTASVQP
TETQAYAADLRFAHAETLVPLLLLLGIDTNGLSPSDPDFFRGLSAMSPFAANLAIELYEA
DSDSRPSHFVRFRLHERYVENIPALGEHGRDGIVELDRLLEFFREVLDEGMQNHANHLSM
SSRFRVFRNKFVGHH
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgtctccaactctcgtttctcgtcttgcttgcttgaccggagcgtccccctcccc
ctcctccccgcccccccatccagcaaatccgaacgcaatcgcgcgaatgactcgcaagca
accaaacctcgccccctacctcatcgcttaatccttcccatcctcattttgtccgctgac
cacccccctactttacctacccctcctccctgtccacatctgaacctatctatgtccctg
attcccactcctcttcccccctctctccaactgaccctgggccccattcatacatcacac
cacgttttcacaaactccgccgtctcgtcactcccactcccacccccatcctctctctcc
tataaaacagtacgacacgcaacccatctccagcaatgccctcgacaacccccacataat
cactctatcttgtcattgcttcataatcagacgttgtccccttttcccttcccttctgtc
cccgcccactctcacacctccccatccatacgtcctccctccctacaactctttccactc
caactcaccgcctcacctccgaagacaccctccaacactcatctttccctcccgataatt
aaaagtaccaccaataccatccccgtcatgttgcatcagcctcaaccacttcaagtgtta
ccccatgcccccctggccgactctcccgcctcgacgctaccacatttgcatcgtcttcgc
gtcctcacgacccctgctctccgcgaaaccaacagtctcactattgctacaccaccgaac
cgcagaaccctcgccgaatggtcctatggcaccaagacaccctatcttcccccgaggctc
attcagcacatcgtcacgtgtccacgctccgaccatcccgctgccgctgcccgtctcatt
catgtctcgctcattgcgaggcatggcactcgcaacccaacgaagacctcgttgcagcgg
atgctctctctctactcttggcttcgtgcggctctcccatccccgcagccgttgtggctg
gaccgctgggagcagactttgaaggtctatagccagaacccgggcgatttgaccattcac
ggcgaacacgagctctgcaacattggaatgcgctttgctcacatctacggccagacactg
catgagacaacgaacaagttccgcatccgctcttcgtacaagaaccgtgccattcaatca
gcaaaggccttccgcatgggatacgtccaagcttgccaacaactaggcatcccactgcct
gacacacatgaattcgaacaggagtccgactctgactccgaacctggcacgacaacaccc
tcggttcattcctgtccctccacgtccgcactaccccgttcaagcgatggggatgaccgt
gtggaggtgcttcccattggccgcgacgcaagtcttcgctactttgaccctcatcatcac
aatgagtacgccacattcgcgacccggtacaagaccgagcaacgacaaaacttctcacaa
agtcttgttcgtcacatcgcggcagagatggcaaaccgtatatcgacaacgttgggagca
accatcccactggaactggatcttgtgcgcgtcatcggagaagtctgtgcttttgagaca
gcacacggccgggctggtaccagtcctttctttcgcctgctcaccccgggagatacacgc
gtcctggaacttgctgatatacgcaaccgtcctttctttaaggcacatgagcgctttaga
gctgctgccgccccgcttgtccaggacattatggactcgctgacggcaagtgtacaacca
actgagacgcaagcctatgctgcagacttgcgatttgcccatgcagagactctggtccct
cttcttcttcttcttggaattgacacgaacgggctctcgccatctgatccggacttcttc
cgaggtctgagcgccatgtctccttttgctgcaaacctcgcaattgagctgtacgaagcg
gatagcgactctagaccttctcacttcgtgcgctttcgtcttcatgagcgttacgttgag
aatatccccgctcttggggagcatggtcgcgatgggatcgtagaacttgatcgactgctg
gagtttttcagagaagttttggacgaaggaatgcaaaatcatgcgaaccacttgtccatg
tcgtcaaggtttagagtatttcgaaacaaatttgtaggtcatcactga

DBGET integrated database retrieval system