KEGG   Chondrus crispus (carragheen): CHC_T00008370001Help
Entry
CHC_T00008370001  CDS       T02916                                 

Definition
(RefSeq) Serine/threonine protein kinase
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
ccp  Chondrus crispus (carragheen)
Brite
KEGG Orthology (KO) [BR:ccp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccp01001]
    CHC_T00008370001
   01009 Protein phosphatases and associated proteins [BR:ccp01009]
    CHC_T00008370001
Enzymes [BR:ccp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CHC_T00008370001
Protein kinases [BR:ccp01001]
 Serine/threonine kinases: Other
  Wnk family
   CHC_T00008370001
Protein phosphatases and associated proteins [BR:ccp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CHC_T00008370001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Ank_2 Ank Ank_5 Ank_4 Ank_3 OSR1_C
Motif
Other DBs
NCBI-GeneID: 17318476
NCBI-ProteinID: XP_005710768
UniProt: R7QQU4
AA seq 1525 aa AA seqDB search
MSATHADSSVAQHVETSPNGRYIRYTDILGRGSYKTVYKAFDTEEALEVAWNKLHVDRLS
AHDLEKVSNEVSLLRQVDHKNIIHFYDFWPGSDANGNQTINFITEQMMSGTLKEYLRKAK
AIKLKVIRRWCSNILAAIAYLHNQEPPIMHRDLKCDNIFINGHVGEVKIGDLGLSGVKER
EKADSVIGTPEFMAPELYEESYTEKVDIYAFGMCLLEIVTMEYPYSECNNMAQIFKKVFS
GEKPHAFSRLVDGDVKEVIAACLEKEARRPSADQLLQHPFFSEWEQDEGSWSNLSLVEGV
PDTAASASLEAAPSSTNMPIGTELIDWSDPLKRNVLVSMIEGEGGGSVDQQVSVVASREN
GGIYIGLEIPIRDAIKRVEFTFDPFADSAQHIAQEMVSEFSLGVEQLTVIREEIDRRVKH
ARLQREAASRNATPQPPARQLPEASSSVSIELPEESLPSRSRPHSQSIQSSLLTSGQSQP
ADLAEEMRAPQVPNAQEPTQRDVANEPLSIVRTPNPNEMDAHYVSDGGETASTVAASQPR
TEHSTPDMPEALIDRTMSHQSLPHTSSFQSSHAHSTTPIETPPGMLSPDTMQQGHAAPSA
PLVTAHVSHAQEPGNGVALPDVPGSHQKDLLRASIEEETPIHVHRSSPRFENAAVSSAPV
RVTEKEQNEGPDNDQIQFVFPQNMAVHHTHRHPDPHTEHHPLGPLSGPDDRDQGPTHHIS
HSTSDTQLRPRPTVPVIETSGRPISTPVRSSSAGIDGQAERQKEVMPAQTLTFQGPETEP
VKTMQQMSQTQSSTDAGRFVPPRQVEEGRIHSYPSSNTGLPRSSSGGIPQIVVVRGSDKS
GGKSRPRHAGNDFASPAVAGFASGEVLPMTAFSSSQNSGMSRGSPDHVAGTHGGHGNVSS
TGTHPKELVRSSSSMSQQRSPAGKAAALRSNSWKSSQSDDSGNNLVPRVPAGMVIGIEHD
EQYYLMCLRLMDHCAKGRVHEVEEKLDAGADPKFSDYDMRTPLHLAAAEGQLQVCSLLLD
KGALVGVRDRWGNTPLGDAVENGHAEVQSLLRDYGAIHDDRVHNVEMIQSALMRSAAAGT
VEAVRSAIVAGAEVTLSDYDRRTPLHLACSEGHYEVSELLLVNGASSEARDRKGRSPVDD
AVNNGHRHVLRLLRQYGANIPRHLFEAQPELENQRGMDLVEHAARGSVDAVRNALGQGAN
PNFEDYDSRTALHLACVEGHLELVKVLLHAGALPTARDRWGSTPAEEARKAGYSDVVDEI
AMWISKRKHRHASIVSFDDSVMNGHDRTATPPGEKDSAHFDQLRHGIASSVSLGAIPSLN
LSADDFAARYPPSSAPSNGDEAHSSCVSLPQSSFDRTNDFSAPDTLDHDERLIRQTFNAK
RQQLEEEHQKAIEDLKRKKNGEESRNLRSPSEVPVVSVISSSQDPKGTSTSPEKLRRIEK
NASKPPVVVSFGPLPNGTEESKRAAARLANGGRDWDQMKLASAVEERNARALPHDRMKRE
LRPSHVNPDIRSIVDTLIDAASNKG
NT seq 4578 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctacccacgctgactcgtcagtggctcagcacgttgagacaagccccaacgga
cgctacattcgttacactgacatcttgggaaggggttcttacaagaccgtttacaaggct
tttgacactgaggaggccctcgaagtcgcttggaacaagcttcatgtagatcgtctttcc
gcacatgatcttgagaaggtctcaaatgaagtctctcttttacgccaagtcgatcacaag
aacatcattcacttttacgacttttggcctgggtctgacgcgaatggcaatcaaactatc
aatttcatcacagagcagatgatgtcgggtactcttaaggaatatctcagaaaagcaaag
gctatcaagctcaaagtcattcgcagatggtgctcaaacattcttgcagcaatcgcatat
ctgcacaatcaggagccacccatcatgcatcgcgacctgaaatgcgataacatttttatc
aacgggcatgtgggtgaggtcaagattggtgatcttggtctttctggtgttaaggagcgt
gagaaagccgactcggttattggaaccccagaattcatggcgcctgaactatacgaggaa
tcctacactgaaaaggttgacatttatgcctttggaatgtgtcttctggaaattgttaca
atggagtacccttactctgaatgtaataatatggcacagattttcaaaaaggtttttagc
ggggagaagcctcacgcattcagcaggttggtcgatggggacgtgaaagaagtcatcgct
gcgtgtcttgagaaagaggcaaggagaccgtcagccgaccaattgctgcagcaccctttc
ttcagtgaatgggaacaggatgaaggcagctggagcaatctctctctcgtggagggcgtg
ccagacaccgctgcttctgctagcctggaggcagcgccgtcgtccaccaacatgccaatt
ggtacggaactcatcgattggtcagatccgctgaagaggaatgtgctcgtcagtatgatt
gagggggagggtggaggatcagtcgatcagcaagtctcagtggtggcctcaagagagaat
ggagggatctacattgggctcgagattcctatccgcgatgcgattaagagggtcgagttt
acgtttgatccttttgcagacagcgcacagcacattgcgcaagaaatggtttcggaattt
agtcttggggttgagcagctcaccgtcatacgcgaggaaatcgacagacgcgtgaagcac
gcgaggctacaacgggaagcagcatctcgaaacgccacaccgcaacctccggcccgccaa
cttcctgaagccagttccagtgtgtctattgagcttccggaggagtctctacccagccga
tcgcgtcctcactctcaatccattcaatcatcactcctgacatctgggcaatcgcaaccg
gcagatctggcggaagaaatgcgagcaccccaggttcctaatgcacaggagccaactcaa
agggatgtcgcaaatgaacccctcagcattgttcggactcccaatccgaacgaaatggat
gcgcattatgtatcagatgggggcgagacggcttcgacagtagcagcatctcagccgcgt
actgaacatagtacgcctgacatgccagaggcgttaattgatcgcacaatgtcgcaccag
agtctccctcatacatcatcctttcaaagttcgcacgcgcactccactactccgattgag
acgccacctggaatgctgtcgccagacactatgcaacagggtcatgcggcgccatctgct
cctctcgtgactgcacatgtatctcatgcacaagagcctggaaatggagttgcgctaccg
gatgttcctggatcgcaccagaaggaccttttgcgtgcgagcattgaagaagagacgcct
atccatgtccatcgcagcagcccacgtttcgagaatgccgcggtctcaagcgctccagtt
cgggtgacagaaaaagaacagaacgaaggacctgacaacgatcaaatacaatttgtgttt
ccccagaatatggctgtgcatcatacacacaggcatccagatccgcatactgagcatcat
cctctagggccgctttcgggacctgatgatcgtgatcaaggaccaacgcatcatatttct
cattccacctctgacacgcaactacgtcctcggcctacggttcctgtgattgaaacgtcg
ggcagaccaatatcaacacccgttcgttcatcttcagccggaatagacgggcaggcggag
cgacaaaaggaggtgatgccggcgcagaccctaactttccaaggcccagagacagaacca
gtcaaaactatgcagcagatgagtcagactcagtcttcgacggacgctggaaggtttgtc
ccgccgcgacaggtagaagagggaagaattcactcctatccctcaagcaacaccggacta
ccgcggtcttcatcaggtggtatcccgcaaattgtagtagttcgcggttcggataagagt
ggcggtaagagcagaccacgccacgcagggaatgattttgcatctccagcagtagctggg
tttgcttctggggaggttttaccaatgactgctttctccagttcacagaacagtggaatg
agtagaggttcccctgatcacgtggctgggactcatggcgggcatggtaatgtgtcttca
actggaactcatcctaaagaacttgtgcggagtagcagttccatgagtcaacaaagaagt
cccgcaggaaaggcagcagctctgagaagcaattcttggaaaagttctcaatccgatgac
agcgggaataatctggttcctcgagttccggcaggtatggtgattggcatcgaacacgat
gagcaatattacttgatgtgtcttagactaatggatcattgtgccaaaggccgcgtgcat
gaagtagaagagaagctggatgccggcgcagatccaaagttttcggattacgatatgagg
acacccttgcatcttgctgccgcggaaggccaattacaagtttgctcattgcttcttgat
aaaggagcactagttggagtacgggaccgttggggaaacacccctttgggagatgcagtg
gagaatggtcatgcggaagtccagtctttgctaagagattatggagcgattcatgatgac
agggtgcacaatgttgagatgattcagtcggcattaatgcgcagtgcggctgcggggact
gtggaggccgtgcgctcggcaatcgttgctggtgcagaagtcaccctgtctgattacgac
aggcgcacccccctccacctagcctgttctgagggtcactatgaagtgtctgaacttctg
ctcgtgaatggagcgtcatcggaagctcgtgacaggaaaggtcgatccccagttgatgat
gctgtcaataatgggcatcgccacgtgctccggttactaagacagtacggtgcgaatatc
ccccgacacttgtttgaagcacaacctgaactcgagaaccaaagaggcatggacttggta
gaacatgcggcgcgcggcagcgtggatgcagtcaggaatgccttgggtcaaggtgcgaat
cccaatttcgaagattacgacagccggactgctcttcatttggcgtgtgtagagggacat
ttagaacttgtcaaggtgctactgcacgctggagctcttcccacagcaagagaccgctgg
ggatctactccagcggaagaggctagaaaggctgggtattcagatgttgtggacgagatt
gccatgtggatatcaaagaggaaacatcggcatgcatcaattgtgtcgttcgacgactcg
gttatgaatggccacgaccgcactgcaacgccaccgggagaaaaggacagcgcacacttt
gaccagctcagacatggaatcgcatcgagcgtatctctgggtgccattccatcgctcaat
ctatctgcagatgacttcgccgccagatatccgccgtcaagtgccccttccaatggggat
gaggcgcatagttcttgtgtgtctttgccacaatcatcttttgatcgaacgaatgatttc
tctgctcctgacaccttggatcatgatgaaagactgattcgacaaacgtttaatgctaag
agacagcagttagaggaagaacatcagaaggcaatagaggaccttaagagaaaaaaaaac
ggtgaagagagcaggaaccttcgcagcccttccgaggtgcccgttgtgtctgtcatatct
tctagccaggacccgaaaggcaccagtacttctccggaaaagttgcggcgaattgaaaag
aatgcgtcaaagccgcccgtggtagtatctttcggccctcttccgaacgggactgaagag
tcaaagagggcggctgcacgcttggcaaatgggggtcgagattgggatcaaatgaaactg
gcgtcagctgtcgaggaaagaaacgcccgtgcacttcctcacgataggatgaagagggag
cttcggccatctcatgtgaatcctgatattcgctccattgtagatacattgattgatgcg
gcatccaacaaaggatga

DBGET integrated database retrieval system