KEGG   Chondrus crispus (carragheen): CHC_T00008425001Help
Entry
CHC_T00008425001  CDS       T02916                                 

Definition
(RefSeq) Glutathione S-transferase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
ccp00350  Tyrosine metabolism
ccp01100  Metabolic pathways
Module
ccp_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:ccp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CHC_T00008425001
Enzymes [BR:ccp01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     CHC_T00008425001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 17322548
NCBI-ProteinID: XP_005714838
UniProt: R7QAF3
AA seq 219 aa AA seqDB search
MSDAAPAATLHSYWRSSCSWRVRLALRLKGVPYSYEAVPLAHGAQHAAPFRALNPAAQVP
VLRIDGVTLRQSVAILEYLEETRPAPPLLPRVPAERAHVRAIVEAVNAGTQPLQNLAVLE
YVKGRWGDEERLAFARHWIEEGLRVVEALLKDSAGECCVGDDVSFADLLLVPQVYNAERV
AVDMESFPTVVRVVRHLERIPAFVDAHADRQPDAPMSQT
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgccgcgcccgcggccacgctgcactcgtactggcgctcctcgtgctcctgg
cgcgtgcgcctggcgctgcggctcaagggcgtgccgtactcgtacgaggccgtgccgctg
gcgcatggcgcgcagcacgccgccccgttccgcgcgctcaacccggccgcccaggtcccc
gtgctgcgcatcgacggcgtcacgctgcgtcagtccgtcgccatcctcgagtacctcgag
gagacgcgcccggccccgccgctgctgccgcgcgtgcccgccgagcgcgcgcacgtccgc
gcgatagtcgaggccgtcaacgccggcacgcagcccctgcagaacctcgccgtcctcgag
tatgtcaagggccgatggggcgacgaggagagactcgccttcgctaggcactggatcgag
gagggcttgcgcgtcgtcgaagccctcctgaaggactctgcgggcgaatgctgcgtcggc
gatgatgtctccttcgcggacttgctcctcgtcccgcaggtgtacaacgcggagagggtc
gccgttgacatggagagcttcccgaccgtggtcagggttgtgcgccatctggagcgtatc
cccgcctttgtcgacgcacacgcggacagacagcccgatgctccgatgtcgcaaacatga

DBGET integrated database retrieval system