KEGG   Chondrus crispus (carragheen): CHC_T00009212001Help
Entry
CHC_T00009212001  CDS       T02916                                 

Definition
(RefSeq) succinyl-CoA synthetase alpha chain
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
ccp00020  Citrate cycle (TCA cycle)
ccp00640  Propanoate metabolism
ccp01100  Metabolic pathways
ccp01110  Biosynthesis of secondary metabolites
ccp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CHC_T00009212001
   00640 Propanoate metabolism
    CHC_T00009212001
Enzymes [BR:ccp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     CHC_T00009212001
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CHC_T00009212001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 Pmp3
Motif
Other DBs
NCBI-GeneID: 17325109
NCBI-ProteinID: XP_005717393
UniProt: R7QG89
AA seq 311 aa AA seqDB search
MASVASSLARAASSRPAPAVSAATRVLFQGFTGKQGTFHAEQALAYGTNVVGGTNPKRAG
QTHLDRPVFATVAEARAETGADASVIFVPPAGAAAAIEEAVEAEMPLVVCITEGIPQRDM
VRVKSVMKDATKTRLIGPNCPGIIKPGACKIGIMPGHIHAPGSIGVVSRSGTLTYEAVHQ
TTAVGLGQSMCVGIGGDPFNGTDFIDCLDYFLQDEETKGIVMIGEIGGQAEEQAADFLQG
HPVKKPVVSFIAGITAPPGRRMGHAGAIIAGGKGTAADKIAALEAAGATVVQSPATMGVT
MFAELQIAGLA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgtcgcctcttccctcgcgcgcgccgcctcgtcgcggcctgccccggccgtc
tctgccgccacgcgcgtgctcttccaaggctttaccggcaagcaaggcacttttcacgcg
gagcaggccttggcctatggcaccaacgtcgtgggcggcacaaacccgaaacgggccggc
cagacccacctcgaccgcccagtcttcgccaccgtcgccgaagcccgcgctgaaactggc
gccgacgcctccgtcatattcgtccctcccgccggcgctgccgccgccatcgaagaggcc
gttgaggccgaaatgcccctcgtcgtttgcatcacggagggaattccgcagagggatatg
gtgcgcgtgaagagcgtcatgaaggatgccacaaaaacgaggttgataggtcccaactgt
ccgggcatcatcaagcctggggcgtgcaagatcggcatcatgccagggcatattcatgcg
ccggggtctataggtgttgtttctagatcggggacgctgacctacgaggctgtgcatcaa
acgacggccgttggacttggacagagcatgtgcgtagggattggcggtgatccgtttaat
ggtacagattttattgattgcttggactactttttgcaggatgaggagacgaagggcatc
gtcatgatcggagagatcggcgggcaggcggaggaacaagctgctgactttttgcaaggc
catccggtgaagaagccggttgttagctttatcgcgggcattaccgccccaccagggagg
aggatggggcatgcgggggccatcatcgctggtggaaagggcactgccgcagacaaaatc
gccgctttggaagctgctggtgctactgttgttcaatccccagctactatgggggttacg
atgttcgcggaattgcaaatagccggattggcatga

DBGET integrated database retrieval system