KEGG   Chondrus crispus (carragheen): CHC_T00009266001Help
Entry
CHC_T00009266001  CDS       T02916                                 

Definition
(RefSeq) beta-glucosidase, belongs to glycoside hydrolase family GH1
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
ccp00460  Cyanoamino acid metabolism
ccp00500  Starch and sucrose metabolism
ccp00940  Phenylpropanoid biosynthesis
ccp01100  Metabolic pathways
ccp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CHC_T00009266001
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    CHC_T00009266001
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    CHC_T00009266001
Enzymes [BR:ccp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     CHC_T00009266001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 17322815
NCBI-ProteinID: XP_005715104
UniProt: R7QCV2
AA seq 523 aa AA seqDB search
MDVVRRGRFRRQLARPKDKPSRSSTALVALTCAAFLAVVASVFLLWHLRPTVVKALPFPE
GFMWGTATASYQIEGAVKSDRAPSIWDRFTHTKGNIYKDQNGDVTVDHYNRFKQDVQLMK
NLNTTHYRFSIAWPRMQTFADPSNPKPNPTGMAFYNALIDELIANDITPFVTLYHWDLPV
AIEDAFGGWAGKGGVVDAFEKYSKLCFETFGDRVKNWITFNEPWCSAVLGYDLGVHAPGD
KSEPGKKVYKAGHNLLLSHGRAVRLYRKEFKEKQRGVIGITLNSNWAEPKNAEDPKTVAA
AQREMDFWLGWYADPIWKGDYPAVMKETLKDRLPSFTEDEKAMLKGSSDFFGVNHYSSGL
IEPMGRVNKRNSPYWKDKGTYESHDRRWKKTDMGWSIVPWGFRKLLVYIHQQYQPEGGII
VTENGLATREDSVAAMQRDTLRVEYLTSYLYGMHEAIQQGADVRGYFLWSLMDNFEWAEG
YRRRFGLYYVDYETLERTAKPAAKWYANVTGHNAVVVEMEVEG
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcgtacggaggggccgtttccggcgacagttggcccgcccgaaagacaagccg
tcgcgatcctcaacagcattggttgccctcacgtgcgccgccttcctggctgtcgtcgct
tccgtttttctcctctggcacctccgcccgaccgtggtcaaagcccttccctttcccgag
ggtttcatgtggggcactgccactgcgtcgtatcagattgaaggcgccgtcaaatcggat
cgcgcgcctagcatatgggatcgcttcacgcataccaagggaaacatctacaaagaccaa
aacggcgacgtcaccgtcgaccattacaaccgcttcaagcaggatgtccagctcatgaag
aacctcaacacgacgcattaccgcttctccattgcctggccgcgaatgcagacctttgcc
gacccttccaatccaaaaccaaacccgactggtatggcgttttacaacgcgcttattgac
gagctcattgccaatgatatcacgcctttcgtcactctgtatcattgggatcttcctgtt
gcgattgaggatgccttcggtgggtgggcaggaaaaggtggtgttgtagacgcgtttgag
aagtattccaaattatgctttgaaacgtttggcgaccgagtcaaaaactggatcaccttc
aacgagccgtggtgctctgctgtactggggtacgatttaggcgtgcatgctcctggtgat
aagtcggaacctgggaagaaggtgtacaaggcgggacataatttgttgctatctcacgga
cgggctgtgcgattgtatcggaaggagtttaaggagaagcagagaggggttatcgggatc
acgctcaacagcaactgggccgagcccaagaacgccgaggacccaaaaacggtggcggct
gcacagagggagatggacttttggttgggttggtatgccgaccctatctggaagggggac
taccccgctgtgatgaaggaaacgctcaaggaccggctgccgagcttcacggaggacgag
aaggcgatgctgaagggaagctcggactttttcggggttaaccactactcatcggggttg
atcgagccgatggggcgcgtgaacaagcgcaactcaccgtattggaaggacaaggggacg
tatgagagccatgatcggcgatggaagaagacggacatggggtggtcgatcgtgccgtgg
ggtttccgtaagctgctcgtttacatccaccagcagtatcaacccgaaggagggatcatc
gtgacggagaatgggctggcgactcgggaagacagtgtggcggcgatgcagcgggacacg
ctgcgagtggagtatttgacgagctatttgtacgggatgcatgaggcgatccagcaaggt
gcggacgtgcggggatactttttgtggagcttgatggacaacttcgagtgggcggagggg
tacaggaggcggttcggattgtactatgtggattacgagacgctggagcggacggccaag
ccggcggcgaagtggtatgcaaacgtgacgggacacaacgcagtcgttgtggagatggaa
gtggaaggatga

DBGET integrated database retrieval system