KEGG   Chondrus crispus (carragheen): CHC_T00009566001Help
Entry
CHC_T00009566001  CDS       T02916                                 

Definition
(RefSeq) elongator protein Elp3p
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
ccp  Chondrus crispus (carragheen)
Brite
Enzymes [BR:ccp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CHC_T00009566001
Transfer RNA biogenesis [BR:ccp03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CHC_T00009566001
Chromosome and associated proteins [BR:ccp03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    CHC_T00009566001
   HAT complexes
    Elongator complex
     CHC_T00009566001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 FR47 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 17321759
NCBI-ProteinID: XP_005714038
UniProt: R7Q853
AA seq 597 aa AA seqDB search
MARGDAVCACAAGAESGTSCVCASEKTGRITPAPRRPRRAADQALAKKAAIAEIVSSLIR
LHATPNAASVTSIKTAAAKRHGLADYPKQVDILAAPVRTASGIAVVAVMSKPHRCPHIAT
TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYVQVRSRVDQLRALGHDVDK
VEFILMGGTFMSLDNTYRDYFIRNLHDALSGHSSQSVKEAVRYSEHSHAKCVALTIESRP
DHSSPHHLSAMLEYGCTRLEIGVQSVYEDVARDTNRGHSVQAVSDCFRLAKDAGFKVVSH
MMPDLPNMGKERDMESFRELFDNPAFRPDGLKIYPTLVIRGTGLYELWKNGLYKNYAPPD
LIDLIARILALVPPWVRVYRIQRDIPMPLVSSGVEHGNLRELSLARMHDLGLPCRDVRTR
EVGIQTIHFQINPEQVELVRRDYVANGGWETFLSYEDAAQDILVALLRLRQAGPGAGAVR
PEMAGEECSIVRELHVYGSVVPVHERDPGKFQHRGFGTLLMEEAERIAAEEHGSTKVVVI
SGVGTRHYYRKLGYVLQGPYMVKNVLLFNLFSLDLCLLNKKEKDTLATAGDLCDAEG
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaggggacgcggtctgcgcctgcgcggccggcgcagaaagcggcacatcctgt
gtatgcgcctcagagaaaacggggcgcattactccggcgccgcgccgcccgcgccgtgct
gcggaccaagcccttgccaagaaagccgccatcgctgagatcgtctcttctctcatccgt
ctgcacgccacgccaaacgccgcctccgtcacatccatcaagacggccgcggcgaagcgc
cacggcctggccgactacccgaagcaggtcgacatcctcgccgcccccgtgcgcacggcg
agcggcatcgctgtcgttgccgtcatgtccaagccgcatcgctgcccgcatatcgctacc
accggaaacatttgcgtctactgccccggaggtccggattctgactttgagtactccact
caaagttacacaggatatgagcccacttctatgcgcgccattagggcccgatacgatcct
tatgtccaggttaggtcaagggttgatcagctgcgtgcgctggggcatgatgtagacaaa
gtcgagtttattctcatggggggcactttcatgtcgttggataatacctaccgcgactac
tttataagaaacttgcatgatgctctcagtgggcattcatcgcagtctgtcaaagaggct
gtcaggtactcggaacactcgcatgccaagtgcgtcgccctgacaattgaaagccgcccg
gaccactcctccccgcaccacttgtcggctatgttagagtacggctgtactagattggag
attggcgtccagagtgtctatgaggacgtcgcgagggatacgaacagagggcattcggtg
caagcagtgagtgactgcttccgtctcgcaaaggatgcaggctttaaggttgtttcacat
atgatgccggatcttccaaatatggggaaggaaagggacatggagtcgttcagagagctt
ttcgacaacccagctttccgtccagacgggctaaagatatatcctacgctcgtcattcgc
ggcactggactttacgaattgtggaagaacggtctttacaagaattacgctccgccagac
ctcatcgaccttatcgcacgaatcctcgcgctagtgccaccgtgggtgcgcgtgtacaga
atacaaagagacatccccatgccgttagtttcatccggggtggaacacggaaacttgcgt
gagctttcactggcacgcatgcacgacctcggtctgccctgtcgcgatgtgcgcacacgt
gaagtgggaatccaaacaattcatttccagattaaccccgagcaggtcgaactcgtgcgc
agagattacgttgcaaatggggggtgggagaccttcctttcatatgaggatgcggctcag
gatattcttgtcgctcttctgcggttgcggcaggctgggccgggtgccggtgcagtcaga
cctgaaatggcaggtgaggaatgcagcattgtccgcgagttgcatgtatatggatccgtt
gtgccggtgcatgagcgggaccccggaaagtttcaacatcgcggctttggtaccttgctg
atggaagaagcagagagaatagccgcagaggagcatgggtcaacgaaagttgtcgttata
tctggagttggaacgcgccattattacagaaagctcggatatgttcttcaaggaccgtac
atggtgaagaacgttctacttttcaacttattttctctcgacttgtgcttgctcaacaag
aaggaaaaagatactctcgccacagcaggtgacttatgcgatgcggaaggatag

DBGET integrated database retrieval system