KEGG   Campylobacter coli 15-537360: N149_1063Help
Entry
N149_1063         CDS       T02895                                 

Definition
(GenBank) 4-keto-6-deoxy-N-Acetyl-D-hexosaminyl-(Lipid carrier) aminotransferase
  KO
K15910  UDP-N-acetylbacillosamine transaminase [EC:2.6.1.34]
Organism
ccq  Campylobacter coli 15-537360
Pathway
ccq00520  Amino sugar and nucleotide sugar metabolism
ccq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    N149_1063
Enzymes [BR:ccq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.34  UDP-N-acetylbacillosamine transaminase
     N149_1063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase Aminotran_5 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGZ21497
Position
complement(1064945..1066105)
Genome map
AA seq 386 aa AA seqDB search
MRFFLSPPHMGGNELKYIEEVFKSNYIAPLGEFVNRFEESVKDYAQCENALALNSATAAL
HLALRVAGVEQDDIVLASSFTFIASVAPICYLKAKPVFIDCDETFNIDIDLLKLAIKESE
KKPKALILTHLYGNAAKMDEIVQICEKENIILIEDAAEALGSFYKGRALGTFGEFGAYSY
NGNKIITTSGGGMLIGKDKQKIERARFYSTQARENCLHYEHLDYGYNYRLSNVLGAIGVA
QMEVLEQRVLKKREIYEWYKEFLGDSFVFLDELENSRSNRWLSTALIDFDKNEMNAYQKC
IEISQKDLILHPKISKLITDLQKEQIETRPLWKAMHTQEVFKGAKAYVNGNSELFFKKGI
CLPSGTAMSKDNVREISELIIKSVKA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaggttttttctttctcctccgcacatgggtggcaatgagttaaaatatatagaagaa
gtatttaaaagcaattatatagctcctttgggcgaatttgtaaatcgttttgaagaaagt
gttaaagattacgctcaatgcgaaaatgctttggcgctaaattcagctacggccgctttg
cacttggctttaagagtagcaggagtggagcaagatgatattgttttagcttcatctttt
acttttattgcttcagtggctcctatttgctatcttaaggcaaaacctgtttttattgat
tgtgatgagacttttaatatagatattgatctgttaaagcttgctattaaagagagcgaa
aaaaaaccaaaagccttaattttaactcatctttatggcaatgcggccaaaatggatgag
atcgtccaaatttgcgaaaaagaaaatattattttaatcgaagatgccgccgaggctttg
ggaagtttttacaagggtagggctttaggaacttttggagaatttggagcttattcttat
aatggaaataaaatcatcaccacttcaggcggtggtatgcttataggtaaagataagcaa
aaaatcgaaagagcgagattttacagcactcaggcaagggaaaattgtttgcattatgaa
catttagattatggttataattaccgcttgagtaatgttttaggcgctattggcgtggcg
caaatggaagttttagaacaaagagtgctaaaaaaaagagaaatttatgagtggtataaa
gaatttttaggtgatagttttgtctttttagatgagcttgaaaattcaagaagcaatcgc
tggttaagcacggctttgattgattttgataaaaacgaaatgaatgcttatcaaaaatgt
atagaaatttcgcaaaaagacttgattttgcatccaaaaatttcaaaacttataacagat
ttgcaaaaagagcaaattgaaacacgcccactttggaaagctatgcatactcaagaggtt
ttcaaaggtgccaaggcttatgtaaatggcaatagtgagttattctttaaaaaagggata
tgcttgccaagtggcacagcgatgagtaaagacaatgtgcgtgaaatttcagaacttatt
atcaagagcgtaaaggcttga

DBGET integrated database retrieval system