KEGG   Campylobacter coli 15-537360: N149_1134Help
Entry
N149_1134         CDS       T02895                                 

Definition
(GenBank) Putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ccq  Campylobacter coli 15-537360
Brite
KEGG Orthology (KO) [BR:ccq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    N149_1134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Flavi_NS4A
Motif
Other DBs
NCBI-ProteinID: AGZ21568
Position
1137794..1139320
Genome map
AA seq 508 aa AA seqDB search
MQKDNLIAFIIFTISVIAFIIWGFGYISQHQLILFILASIFGIFMAFNIGGNDVANSFGT
SVGAKTVTIKQALIIAAVFELSGAIFAGAEVTKTIRSGIVIFPEQFDPMLFVAIMLAALL
SSGVWIFIATKKGLPVSTTHSIIGGIVGASIMMGLLKFDGSQTLSMVKWSEIVRIAVSWV
ISPLLGGLVAYIIYSYIDKKILKPSEKLGEELKNLKKERKKFKENYFLNLKTKSMEEQIK
ELSAIALEDEGQENSFYKNQIKEFKEKEKNIDIYSVLKTHMPIIACIGAAIIAAMFLFKG
LNNVSTLDILQNFWIIGIVGTISYVVTFAIVKIVKKTELNKTTDRLFAWFQIFTASSFAF
SHGANDIANAIGPFAAILDVLKNGTINANSPVPFAALAMFGVALVIGLWFLGKEVITTVG
SKLASIRPTTGFSAELGASIVILLATQFGIPVSSTHILIGAVLGIGVYNKNANWMMMKPI
GLAWIITLPAAGIMAALVFLGFKLSLGL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagataatcttatcgcatttatcatctttaccattagcgtaatcgcatttatc
atttggggatttggctatatctcccagcaccaactcatactctttatactcgcttccatt
tttggcatatttatggcatttaacataggcggaaatgatgtagcaaattcttttggtact
agtgtgggagctaaaaccgtaaccataaaacaagctttgatcatagcagctgtttttgaa
ctcagcggtgctatttttgcaggggctgaagtaaccaaaactatacgcagtggaatagtt
atatttcctgaacaatttgatcctatgctttttgttgctatcatgctagccgctctttta
agctcgggtgtttggatttttatcgccacaaaaaaaggcttgcctgtatctactacacat
agtatcattggtggtatagttggagctagtatcatgatggggcttttaaaatttgatgga
tcacaaaccttatccatggttaaatggagcgaaatagtaaggattgctgtatcttgggtg
atttcacctcttttaggaggacttgtagcttatatcatctactcttatatagataaaaaa
atactcaaaccctcagagaaacttggcgaagaattaaaaaatttaaaaaaagaaagaaag
aaatttaaagaaaattattttttaaatcttaaaaccaaaagtatggaagagcaaatcaaa
gaactctcagccatagccttagaggatgaaggacaagaaaatagcttctataaaaatcaa
atcaaagaatttaaagaaaaagaaaaaaatatagatatttattctgttttaaaaacacat
atgcctattatcgcttgcattggagctgctataattgctgctatgtttttatttaaaggt
ttaaataatgttagcactttagatattttgcaaaatttttggattataggaattgtagga
accataagctatgttgtaacctttgccatagtaaagattgttaaaaaaaccgaattaaac
aaaacgaccgatagactttttgcttggtttcaaatttttaccgcttctagttttgctttc
tctcatggggctaatgatatagctaatgctattggcccttttgctgcgattttagatgtt
cttaaaaacggtactatcaatgcaaattctcccgtaccttttgctgctctagctatgttt
ggagtcgctttggttataggactttggtttttaggaaaagaagtaattaccactgtgggt
tctaagctagcttctatacgccctaccacaggatttagcgcagaacttggagcaagtata
gtcatacttttagcaactcaatttggaattccagtaagctcaacacatattttaatcggt
gcagttttgggtataggggtatataataaaaatgcaaattggatgatgatgaaacctata
ggtttagcttggattattactttgccagccgctgggataatggcagcacttgtattccta
ggatttaaattaagcttaggactttaa

DBGET integrated database retrieval system