KEGG   Caulobacter vibrioides CB15: CC_0024Help
Entry
CC_0024           CDS       T00049                                 

Definition
(RefSeq) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
ccr  Caulobacter vibrioides CB15
Pathway
ccr00860  Porphyrin and chlorophyll metabolism
ccr01100  Metabolic pathways
ccr01110  Biosynthesis of secondary metabolites
ccr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CC_0024
Enzymes [BR:ccr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     CC_0024
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     CC_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CysG_dimeriser NAD_binding_7 TP_methylase Sirohm_synth_M Borealin
Motif
Other DBs
NCBI-GeneID: 943489
NCBI-ProteinID: NP_418844
UniProt: Q9AC42
Position
24133..24981
Genome map
AA seq 282 aa AA seqDB search
MVIAGSGEAAEAKARLFDGSPATLVRLDGHAAYLPGSYSGAAFAFIASSDEVFVQAAAGA
ARAARVLVNVVDRPELCDFNTPAVIDRGQVVAAVGTGGGAPVLATMLRNDIEAQVPEGTG
RVAALLAKFQTEVRKTLPALHERRAFLRDAVMGEAAAAAREGDMDRAGQLFREALAKGGA
RKGVVRFIAGKGPADLLTLRALRALGSADVLVLDGDVEPEVLKMARRDAERLDADGADAP
HLIQLAREGRQIVRLITHPVDPALVHALTQAEVAVEVLPVAT
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatcgccgggtccggcgaagccgccgaggccaaggcccggctgttcgacggctcg
cccgcgacgctggttcgcctggatggtcacgccgcctatctgccagggtcctatagtggc
gccgccttcgccttcatcgccagctccgacgaggtcttcgtgcaggcggccgccggcgcg
gcgcgcgcggcccgggtcttggtcaatgtcgtggatcgtcccgagctctgcgacttcaat
acgcctgcggtgatcgaccggggccaggtggtcgcggcggtgggcacgggcggtggagcg
ccggtcctggccaccatgctgcgcaacgacatcgaggcccaggtgccggagggcacgggc
cgggtggcggccttgctcgccaagttccagaccgaggtccgcaagaccctgccggctttg
cacgagcgccgcgccttcctgcgcgatgcggtgatgggcgaggccgccgccgccgcccgc
gagggcgacatggatcgtgcgggccagctcttccgcgaggccttggccaagggcggcgcg
cgcaagggcgtcgtgcgcttcatcgccggcaaggggccggccgacctgctcaccctgcgc
gcgctccgcgccctcggctccgccgatgtcctggtgctggacggcgacgtcgagcccgag
gtgctgaagatggcgcgccgcgacgccgagcggctggatgcggatggggccgacgcccca
cacctgatccagctggcccgcgagggtcgccagatcgtccggctgatcacgcatccggtg
gatccggccctggtgcacgccctgacccaggccgaggtcgcggtcgaggttctccccgtc
gcgacctga

DBGET integrated database retrieval system