KEGG   Caulobacter vibrioides CB15: CC_0146Help
Entry
CC_0146           CDS       T00049                                 

Definition
(RefSeq) deoxyribonucleotide triphosphate pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
ccr  Caulobacter vibrioides CB15
Pathway
ccr00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:ccr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CC_0146
Enzymes [BR:ccr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     CC_0146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-GeneID: 944206
NCBI-ProteinID: NP_418965
UniProt: Q9ABS4
Position
complement(156966..157550)
Genome map
AA seq 194 aa AA seqDB search
MGAKLVAATHNPGKVPEIAALLDGRFEIVTAGQLGLPEPDETESTFVGNALLKARHAADL
SGLPALADDSGLSVTALDGAPGIFSARWAGPGKDFALAMKKVEERLEETASDDRTAWFTS
ALAVAWPNGPAVVVEGRVDGTLVFPGRGTRGFGYDPIFVPEGHALTFGEMEPAAKDAMSH
RARAFAKLKAALFD
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtgggagcaaagcttgtggccgccacccacaatcctggcaaggtccccgagatcgccgcc
ttgctggatggccggttcgagatcgtcaccgccggccagttgggcctgcccgaaccggac
gaaaccgagagcaccttcgtcggcaacgcgctgctgaaggcccgtcatgccgcagacctg
tcgggcctgcccgccctggcggatgattcgggcctgtcggtcaccgcgctggacggcgcg
ccgggcatcttctccgcccgctgggccggtccgggcaaggacttcgccctggccatgaag
aaggtcgaggagcgcctggaagagaccgcgtcggacgatcgcaccgcctggttcacctcg
gccctggccgtggcctggccgaacggcccggcggtcgtggtcgaaggccgcgtggatgga
accctggtgttcccgggacgcgggacgcgcggctttggctatgatccgatcttcgtcccc
gagggccacgccctgaccttcggcgagatggagccggccgccaaggacgccatgagccat
agggcccgcgccttcgccaagctaaaggcggccctgtttgactga

DBGET integrated database retrieval system