KEGG   Caulobacter vibrioides CB15: CC_0446
Entry
CC_0446           CDS       T00049                                 
Name
(GenBank) TonB-dependent receptor
  KO
K02014  iron complex outermembrane recepter protein
Organism
ccr  Caulobacter vibrioides CB15
Brite
KEGG Orthology (KO) [BR:ccr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccr02000]
    CC_0446
Transporters [BR:ccr02000]
 Other transporters
  Pores ion channels [TC:1]
   CC_0446
SSDB
Motif
Pfam: TonB_dep_Rec OMP_b-brl_3 Plug
Other DBs
NCBI-ProteinID: AAK22433
UniProt: Q9AAZ6
Position
461992..464661
AA seq 889 aa
MKTIRKSVLAASASAMVVMIAAPAMAQSGGNEVEQVVITGIRASLLQSIESKRKADAIVD
VVTAEDVGKFPSTNVAEALTIVPGVTVDRAFGQGEKVSILGTDPALNRTLLNGQTVASAD
WFILDSPGRTFNYALLAPQIVGKVDVYKSPEARIDEGSIGGTVIVNTRKPLDLKSGTIAG
AVSYLYTDRSKKGDLQGSLLASWKNADSTFGASFSIQRAEDQLRRDGVETYGTIAANQWA
GGNPDNPVDSRTKGCVGSCASTLTANLGARSPNAFGASYFEQGRTRTTYTTALQYKPNDQ
LSLEFNWLKIDADYDNTNQSMYAFQGNTWNSLGALTGLTVNNGVVSKASFNNALSVLDVQ
HREAGLKSDTFHLKGGYKGDGWDLNGEVGKSTADGGTKRQVFLEFLNWASYTVDISGAPK
SPGSLTYTTNVLGNPSAFATDPGWSGNLVSKPTSDEEKYAQFDFGKDFDGVIQRVQVGYK
RREHQTGQQYAGIAITGVAAPASSFNPSTVPSNYLKGFDGVGTQMQNRFRIDGNAMVSYV
ESGKWLAAGATMPKPSIFAAAEFTAGNWNIQEDIDALYAQANFKADNVRGNFGVRYVKTS
VDSAGYVCKPGAACNKAADWSWKSTKKSYDNVLPSVNIIVDAREDLVLRFAAAQVIARPN
YSDMTNYFWLSDGILTGGGGNPALEPYKSSNFNASAEWYFQPQAILSAEVFYKDISNYIL
QRTQPESYFNQSQGKVTTYQISRPFNAGSAEVKGLAMAYQQTFGGGFGLLANYTYADASG
QSGAPLPYSSKNQVNLSPFYENGPFSARATFTWRSKYFTGVDRGDDMFVKAAKTLDATVG
YAVTKNITMSLSGQNLLDSEYYAYANTTALPRGVYRTGRKLQATLNVAF
NT seq 2670 nt   +upstreamnt  +downstreamnt
atgaagactatccgtaaatccgtcctggcggcgtccgccagcgccatggtggtcatgatc
gccgcgccggccatggcccagagcggcggcaacgaggtggagcaggtggtgatcaccggg
atccgcgcctcgctgctgcaatcgatcgagtccaagcgcaaggctgacgcgatcgtcgac
gtggtcaccgccgaggatgtgggcaagttcccgagcacgaacgtcgccgaggcgctgacc
atcgttccgggcgtcaccgtcgatcgcgccttcggtcaaggcgagaaggtcagcatcctg
ggcaccgaccccgcgctgaaccgcaccctgctcaatggccagaccgtcgcctcagccgac
tggttcatcctggattctccgggccgcaccttcaactatgcgctgctggcgccgcagatc
gtcggcaaggtcgacgtctacaagtcgcccgaagcgcgcatagacgaaggcagcatcggc
ggcactgttatcgtcaacacccgcaagccgctggacctgaagtccggcacgatcgccggc
gcggtaagctatctctacaccgatcgctcgaagaagggcgatctgcagggctcgctgctg
gccagctggaagaacgctgacagcaccttcggcgccagcttctcgatccagcgcgcggaa
gatcagctgcgtcgcgacggcgtcgagacctacggcacgatcgcggcgaaccagtgggcc
ggcggcaacccggacaatccggtcgactcgcgcaccaaggggtgcgtcggctcgtgcgcc
agcacgctgacggcgaacctgggcgcccgcagcccgaacgcctttggcgcgtcctatttc
gagcagggccgcacgcgcacgacctacaccacggcgctgcagtacaagccgaacgaccag
ctctcgctggagttcaactggctgaagatcgacgccgactacgacaacaccaaccagtcg
atgtacgccttccagggcaacacctggaacagcctgggcgccctgaccggcctgaccgtc
aataacggcgtcgtctccaaggcttcgttcaacaacgcgctcagcgttctggacgtgcag
caccgtgaggccggcctgaagtccgacaccttccacctgaagggcggctacaagggcgat
ggttgggacctgaacggcgaggtcggcaagtcgaccgccgacggcggcaccaagcgtcag
gtgttcctcgaattcctgaactgggccagctacacggtcgacatcagcggcgcgcccaag
agcccgggcagcctgacctacaccaccaacgtgctgggcaatccgagtgcgtttgcgacc
gatccgggctggagcggcaaccttgtcagcaagcccacctcggacgaggaaaagtacgcc
cagttcgacttcggcaaggacttcgacggcgtgatccagcgcgtccaggtcggctacaag
cgtcgtgaacaccagacgggccagcagtacgcgggcatcgccatcaccggcgtcgccgct
ccggcctcgtcgttcaatccctcgaccgtgcccagcaactatctgaagggcttcgacggc
gtcgggacccagatgcagaaccgcttccgcatcgacggcaatgcgatggtctcgtacgtc
gaaagcggcaagtggctggcggcgggcgccaccatgcccaagccctcgatcttcgcggcc
gccgagttcaccgccggcaactggaacatccaggaagacatcgacgccctttacgcccag
gccaacttcaaggccgacaacgtgcgcggcaacttcggcgtccgctatgtgaagacctcg
gtcgacagcgccggctatgtctgcaagcccggcgcggcctgcaacaaggcggccgactgg
agctggaagtcgaccaagaagagctacgacaacgtcctgcccagcgtgaacatcatcgtc
gacgcccgtgaggacctcgtccttcgcttcgcggcggcccaggtgatcgcgcgtccgaac
tattcggacatgactaactacttctggctgtcggacggcattctcacgggcggcggcggc
aacccggcgctggagccctacaagtcgagcaacttcaacgcctcggccgagtggtacttc
cagccccaggcgatcctgtcggcggaggtgttctacaaggacatctccaactacatcctg
cagcgcacccagccggaatcgtacttcaaccagtcgcaaggcaaggtcacgacctatcag
atcagccgtccgttcaatgcgggctcggctgaggtcaagggtctggcgatggcctaccag
cagaccttcggcgggggctttggccttctggccaactacacctacgccgacgcctcgggc
cagtcgggcgcgccgctgccctacagctcgaagaaccaggtcaatctcagccccttctac
gagaacggtccgttctcggcccgggccaccttcacctggcgctcgaagtacttcaccggc
gtcgatcgcggcgacgacatgttcgtcaaggccgccaagaccctcgacgccaccgtgggc
tacgccgtgaccaagaacatcacgatgtcgctctccggccagaacctgctggacagcgag
tactacgcctacgccaacaccacggccctgccgcgcggcgtctaccgcacgggccgcaag
ctgcaagccacgctgaacgtcgcgttctaa

DBGET integrated database retrieval system