KEGG   Caulobacter vibrioides CB15: CC_0700Help
Entry
CC_0700           CDS       T00049                                 

Definition
(RefSeq) lipoprotein signal peptidase
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
ccr  Caulobacter vibrioides CB15
Pathway
ccr03060  Protein export
Brite
KEGG Orthology (KO) [BR:ccr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    CC_0700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccr01002]
    CC_0700
Enzymes [BR:ccr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     CC_0700
Peptidases [BR:ccr01002]
 Aspartic Peptidases
  Family A8: signal peptidase II family
   CC_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_A8 DUF2593 CorA
Motif
Other DBs
NCBI-GeneID: 941456
NCBI-ProteinID: NP_419517
UniProt: Q9AAA6
Position
complement(767113..767619)
Genome map
AA seq 168 aa AA seqDB search
MPSLSITRQGWIAYAIAAVTVVLDQISKLWILGLLGREPGASLPLLGPIHLTMVHNYGMS
FGLLRDSDWGRWLLIGFSILVVIGLAVWVHKATRPLLAVGIGLIIGGAIGNNLIDRVIYG
YVVDFIDVSRLYFPWVFNIADSGISVGVALLLLDSFLSEENKLSHQTE
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
ttgccgtcactctccatcacccgccaaggctggatcgcctacgccatcgccgccgtcacg
gtggtgctggaccagatctccaagctgtggatcctgggcctcttgggccgtgagccgggc
gcgagcctgccgctgctgggcccgatccacctgaccatggtccataactacggcatgagc
tttggcctgctgcgcgacagcgactggggccgctggctgttgatcggcttttcgatcctg
gtggtgatcggcctcgccgtctgggtccacaaggcgacgaggccgctgctggcggtaggg
atcgggctgatcatcggcggggccatcggcaacaacctgatcgaccgggtgatctacggc
tatgtcgtcgacttcatcgacgtctcgcgcctgtatttcccctgggtgttcaacatcgcc
gactcggggatctcggtgggcgtggccctgcttctgctcgacagcttcctgtcggaagag
aacaaactgtcgcatcagaccgagtag

DBGET integrated database retrieval system