KEGG   Caulobacter vibrioides CB15: CC_1216Help
Entry
CC_1216           CDS       T00049                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ccr  Caulobacter vibrioides CB15
Pathway
ccr00010  Glycolysis / Gluconeogenesis
ccr00053  Ascorbate and aldarate metabolism
ccr00071  Fatty acid degradation
ccr00280  Valine, leucine and isoleucine degradation
ccr00310  Lysine degradation
ccr00330  Arginine and proline metabolism
ccr00340  Histidine metabolism
ccr00380  Tryptophan metabolism
ccr00410  beta-Alanine metabolism
ccr00561  Glycerolipid metabolism
ccr00620  Pyruvate metabolism
ccr00625  Chloroalkane and chloroalkene degradation
ccr00903  Limonene and pinene degradation
ccr01100  Metabolic pathways
ccr01110  Biosynthesis of secondary metabolites
ccr01120  Microbial metabolism in diverse environments
ccr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ccr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CC_1216
   00053 Ascorbate and aldarate metabolism
    CC_1216
   00620 Pyruvate metabolism
    CC_1216
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CC_1216
   00561 Glycerolipid metabolism
    CC_1216
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CC_1216
   00310 Lysine degradation
    CC_1216
   00330 Arginine and proline metabolism
    CC_1216
   00340 Histidine metabolism
    CC_1216
   00380 Tryptophan metabolism
    CC_1216
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CC_1216
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CC_1216
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CC_1216
Enzymes [BR:ccr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CC_1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh GGDEF_2
Motif
Other DBs
NCBI-GeneID: 941627
NCBI-ProteinID: NP_420030
UniProt: Q9A8Y1
Position
complement(1374109..1375632)
Genome map
AA seq 507 aa AA seqDB search
MTQVFPTPAAHAREILAKLGAPPLPADAGEPVRGPIDGAILGHVVYDDARQIEAKVAAAC
RAFADWRVVPAPRRGELVRLFGEELRAAKADLAALVTLEAGKIASEAAGEVQEMIDICDF
AVGLSRQLHGLTIASERPGHAMRETWHPLGPVAVISAFNFPVAVWAWNACLALVCGDPVI
WKPSEKTPLTALATQAILERALARFRDAPQGLSSVVLGARDAGERLARDPRIPLVSATGS
TRMGRAVAPMVAERFGRSILELGGNNAMIVTPSADLSLALRAIVFSAAGTAGQRCTSLRR
LIVHESLVDKVSDAVEAAFQRLSVGDPRDPKTLLGPLIDKAAYDAFIAAMNQVRAEGGSV
AGGERVLIDEHPDAYYVRPALARLPAPAPCMQRETFAPLLHVVPYNSFDMAIAIQNDVPQ
GLSSCVMTNDVREAERFLAAAGSDCGIANVNIGPSGAEIGGAFGGEKETGGGRESGSDSW
KQYMRRQTATVNYSGALPLAQGVRFDL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagtcttcccgactcccgccgcccatgcccgcgagatcctggccaagctgggc
gcgccgccgctgcccgccgacgccggagagcctgtgcgcggcccgatcgacggcgcgatc
ctgggccatgtcgtctacgacgacgcccggcagatcgaggccaaggtcgctgccgcctgc
cgcgccttcgccgactggcgcgtggtccccgccccgcgtcgcggcgagctggtccggctg
ttcggcgaagagctgcgcgcggccaaggccgatctggccgccctcgtcaccctggaagcc
ggcaagatcgcctccgaggcggccggcgaggttcaggagatgatcgacatctgcgacttc
gccgtgggcctgtcgcggcaactgcacggcctgaccatcgcctcggagcgccccggccac
gccatgcgcgagacctggcatccgctggggccggtggcggtgatcagcgccttcaacttc
cccgtcgccgtctgggcctggaacgcctgcctggccttggtctgcggcgatccggtaatc
tggaagccgtccgagaaaaccccgctgacggcgcttgcgacccaagcgatcctggagcgc
gcgctcgcccgcttccgcgacgcgccgcagggtctctcctcggtcgtgctgggcgcccgc
gacgccggcgagcgactggcgcgcgatccgcgcattccgctggtcagcgccaccggctcc
acccgcatgggccgggccgtcgcccccatggtcgccgagcgcttcggccgctcgatcctg
gagctgggcggcaacaacgccatgatcgtcacgccctcggccgacctgtcgctggcctta
cgcgccatcgtcttctcggcggcgggcacggcgggccagcgctgcacgtccctgcgccgc
ctgatcgtccacgagagcctcgtcgacaaggtcagcgacgcggtcgaggccgccttccag
cgcctgtcggtcggcgatccgcgcgatcccaagaccctgctgggcccgctgatcgacaag
gccgcctatgacgcctttatcgcggcgatgaaccaggtccgcgccgagggcggaagcgtc
gccggcggcgagcgcgtgctgatcgacgaacaccccgacgcctactatgtgcgccccgcc
ctcgcccgcctgcccgcccccgcgccctgcatgcagcgcgagaccttcgcgcccttgctg
cacgtcgtgccctacaacagcttcgacatggccatcgcgattcagaacgacgtgccccag
gggctgtcctcctgcgtgatgaccaacgacgtccgcgaggccgagcgcttcctggccgcc
gccggcagcgactgcggcatcgccaacgtcaacatcggcccctcgggcgccgagatcggc
ggcgcgttcggcggcgaaaaggaaaccggcggcggccgcgagagcggctccgacagctgg
aagcaatatatgcgccgccagaccgcgacggtgaactactccggcgccctacccctggcg
cagggggtgcggtttgatctgtag

DBGET integrated database retrieval system