KEGG   Caulobacter vibrioides CB15: CC_1253Help
Entry
CC_1253           CDS       T00049                                 

Gene name
rplV
Definition
(RefSeq) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ccr  Caulobacter vibrioides CB15
Pathway
ccr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ccr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CC_1253 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ccr03011]
    CC_1253 (rplV)
Ribosome [BR:ccr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CC_1253 (rplV)
  Bacteria
    CC_1253 (rplV)
  Archaea
    CC_1253 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 942927
NCBI-ProteinID: NP_420066
UniProt: Q9A8U8
Position
1408518..1408898
Genome map
AA seq 126 aa AA seqDB search
MAKQKQERRLPAAEAMCKVRTLRTSPRKLNLVAQSIRGLNVQRALNELEFSHKRIAQDVR
KALYSAISNAENNHNLDIDSLVVAEAYVGKNLIMKRFSPRARGRATRVEKPFSEITIVVR
ELGEAA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcagaagcaagaacgccgcctgccggccgccgaagcgatgtgcaaggtgcgc
accctgcgcaccagcccgcgcaagctgaatctggtcgctcagtccatccgtggtctgaac
gtccagcgcgctctcaacgagctcgagttcagccacaagcgcatcgctcaggacgtccgc
aaggcgctgtactcggcgatctcgaacgccgagaacaaccacaacctcgacatcgactcc
ctggtcgtggccgaggcctatgtgggcaagaacctgatcatgaagcgtttctcgccccgc
gctcgcggtcgcgcgacgcgcgttgagaagccgttctccgagatcacgatcgtggtccgc
gaactgggtgaggccgcctaa

DBGET integrated database retrieval system