KEGG   Caulobacter vibrioides CB15: CC_1430Help
Entry
CC_1430           CDS       T00049                                 

Definition
(RefSeq) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
ccr  Caulobacter vibrioides CB15
Pathway
ccr00540  Lipopolysaccharide biosynthesis
ccr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CC_1430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ccr01005]
    CC_1430
Enzymes [BR:ccr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     CC_1430
Lipopolysaccharide biosynthesis proteins [BR:ccr01005]
 Unusual sugar
  CC_1430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 adh_short KR Ldh_1_N
Motif
Other DBs
NCBI-GeneID: 940831
NCBI-ProteinID: NP_420243
UniProt: Q9A8C4
Position
1580978..1581979
Genome map
AA seq 333 aa AA seqDB search
MSRRIVLVTGGAGFIGSNIVARLCEDPALDVVVCDRLRDAASGKWRNIAKHAIADFVAPE
QLFDWLAKRGGEVELVVHMGAVSSTTEVDADKIVQSNFVLSRDLWDWCAQHGKRLIYASS
AATYGDGALGFDGKDDLASLQALRPLNAYGWSKALFDIYAVREAQRGRAPAQWAGLKFFN
VYGPNEDHKGGMKSVAAQIWPRIAAGEGVKLFKSHHPDYEDGGQLRDFVYVRDVVDVVGW
LAKSPAVNGVFNLGSGQARSFRDLAVATFEAAGRAPDITYIDMPEVLRGKYQYYTQADMS
RLRAAGYNAPMTALEDGVADYVAGYLNTEDPYR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccgcatcgtcctggtcaccggcggcgccggcttcatcggttcgaacatcgtc
gcgcgcctctgcgaggatccggcgctggatgtcgttgtctgcgaccgcctgcgcgatgcg
gccagcggcaagtggcgcaacatcgccaagcatgcgatcgccgacttcgtcgcgcccgag
cagctgttcgactggctcgctaagcgcggcggtgaggtcgaactggtggtccacatgggc
gcggtctcgtcgaccaccgaggtcgacgcggacaagatcgtgcagtccaacttcgtcctg
tcacgcgacctgtgggactggtgcgcccagcatggcaagcgcctgatctacgcctcgtcc
gccgccacctatggcgacggcgcgctgggctttgacggcaaggacgatctggcgtcgctg
caggccctgcggccgctgaacgcctatggttggtccaaggctttgttcgacatctacgcc
gtgcgcgaggcccagcgcgggcgtgcgccggcccaatgggcggggctgaagttcttcaac
gtctacgggcccaatgaggaccacaagggcggcatgaagtcggtcgcggcccagatctgg
ccgcgcatcgcggcgggcgagggcgtcaagctcttcaagtcgcatcacccggattacgag
gacggcggccagcttcgcgacttcgtttatgtccgcgacgtggtcgacgtcgtcggctgg
ctggccaagagccccgccgtgaacggcgtcttcaacctcggctcgggccaggcgcgttcg
ttccgtgatctggcggtggccacgttcgaggccgcgggtcgtgcgcccgacatcacctat
atcgacatgcccgaggtgctgcgcggcaagtatcagtactacacccaggccgacatgagc
cgcctgcgcgcggccggctacaacgcgccgatgaccgcgctggaagacggcgtggccgac
tatgtggcgggctatctgaacaccgaagatccctatcgctga

DBGET integrated database retrieval system