KEGG   Caulobacter vibrioides CB15: CC_1899Help
Entry
CC_1899           CDS       T00049                                 

Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ccr  Caulobacter vibrioides CB15
Pathway
ccr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccr01100  Metabolic pathways
ccr01110  Biosynthesis of secondary metabolites
ccr01130  Biosynthesis of antibiotics
ccr01230  Biosynthesis of amino acids
Module
ccr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CC_1899
Enzymes [BR:ccr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CC_1899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS CP_ATPgrasp_2 FMN_dh Lactamase_B_5
Motif
Other DBs
NCBI-GeneID: 942554
NCBI-ProteinID: NP_420706
UniProt: Q9A727
Position
2094921..2095709
Genome map
AA seq 262 aa AA seqDB search
MTDILAKIAAYKREDVAARKAERSQAEIDAAAKAASAPRGFKAALEAHHAPGRLSLIAEI
KKASPSKGLIREDFDPPVLAKAYEAGGAACLSVLTDGPSFQGADDYLVTARAAVALPCIR
KDFLVDPWQVAESRALGADAILVILAMIDDVLAAELMSEARRLGMDALVEVHDEAEMARA
GALGSDLVGINNRDLKSFVVDLAVTERLSAQAPRDALLVTESGIFTHDDVVRMEATGAKA
MLVGESLMRHADVTSATRALIA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacatcctggccaagatcgccgcctacaagcgtgaggacgtggcggcgcgaaaa
gccgagcggtctcaagccgagatcgacgccgccgccaaggccgcttcggcgccgcgcggc
ttcaaggccgcccttgaggcgcatcacgcgcccggccgtctctccctgatcgccgagatc
aagaaggcctcgccgtccaagggcctgatccgcgaggacttcgatccgccggtcctagcg
aaagcctatgaagccggcggcgcggcctgcctctccgtgctgaccgatggaccgagtttt
cagggcgcggatgactacctcgtcaccgcccgggcggcggtcgccctgccctgcatccgc
aaggatttcctggtcgatccctggcaagtggccgaaagccgcgccctgggcgccgacgcg
atcctggtgatcctggcgatgatcgacgacgtcctggcggcggagctgatgtccgaagcg
cgtcggctgggcatggacgcccttgtcgaggtgcacgatgaggccgaaatggcgcgcgcc
ggcgctttgggctcggatctggtcggcatcaacaaccgtgatctcaagagctttgtcgtc
gatctggcggtgaccgagcgcctgtcggcccaggccccgcgcgacgccctgctggtcacc
gaaagcggcatcttcacccatgacgatgtcgtccgcatggaagccaccggggccaaggcc
atgctggtcggcgaaagccttatgcggcacgcggacgtgacgagcgccacgcgcgccctg
atcgcttaa

DBGET integrated database retrieval system