KEGG   Caulobacter vibrioides CB15: CC_2239Help
Entry
CC_2239           CDS       T00049                                 

Gene name
apaG
Definition
(RefSeq) ApaG protein
  KO
K06195  ApaG protein
Organism
ccr  Caulobacter vibrioides CB15
Brite
KEGG Orthology (KO) [BR:ccr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CC_2239 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-GeneID: 943168
NCBI-ProteinID: NP_421042
UniProt: Q9A655
Position
2438720..2439184
Genome map
AA seq 154 aa AA seqDB search
MRSIRRETSPPMQRMRRRRGSDSAAYEARTRDIVVRVFPTYAAEESSPEQGLYLWSYTVE
IENHGEETVTLIARRWTITDGFNRVNEVEGSGVVGEQPELKPREAFRYVSNCPLPTPSGA
MRGSYQMVTDAGDLFDVAIPEFSLHLPGAAMKLN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtgcgctcgatcaggcgtgagacctccccgcccatgcaacgcatgagacgccgccggggc
agcgacagcgccgcctatgaggcccgcacgcgcgacatcgtcgtgcgcgtcttccccacc
tatgcggccgaggaaagctcgcccgagcagggcctctatctgtggtcctacacggtcgag
atcgagaaccacggcgaagagacggtcaccctgatcgcgcgccgctggacgatcaccgac
ggcttcaaccgggtgaacgaggtcgagggcagcggcgtggtcggcgaacagcccgagctg
aagccgcgcgaggcgttccgctatgtctccaactgccctctgcctacgccgtcgggcgcg
atgcgggggagctaccagatggtcaccgacgcgggcgacctgttcgacgtggcgatcccg
gagttctcgctgcacctgccgggcgcggcgatgaagctcaactga

DBGET integrated database retrieval system