KEGG   Caulobacter vibrioides CB15: CC_2287
Entry
CC_2287           CDS       T00049                                 

Name
(GenBank) TonB-dependent receptor
  KO
K02014  iron complex outermembrane recepter protein
Organism
ccr  Caulobacter vibrioides CB15
Brite
KEGG Orthology (KO) [BR:ccr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccr02000]
    CC_2287
Transporters [BR:ccr02000]
 Other transporters
  Pores ion channels [TC:1]
   CC_2287
SSDB
Motif
Pfam: TonB_dep_Rec Plug
Other DBs
NCBI-ProteinID: AAK24258
UniProt: Q9A608
Position
2488159..2490924
AA seq 921 aa
MNTQFSRRRAWLMAGGATGLALAFAVAGSAQAQTTTTAADDTKVEEVVITGIRAGLENSI
ALKKQSTSIVEAISAEDIGKLPDTSIAESLARLPGLTAQRLDGRAQVISIRGLGPDFTST
LLNGREQVSTGDNRGVEFDQYPSEILSGVVVYKTPDAGLIGQGLSGTADLRTIRPLTYGK
RILSANARYEMNSEKKLNPDAKDTGHRFSATYVNQFANDTVGLALAISDISTPTQSKRFN
AWGYPTINAANDRVIGGAKPYIQSNNLERFGAIGVLEYKPNDKVTTSLDVYYSEFQEEQI
LRGIELPLQWSSATLQPTRTTTAGLITNGTFSGVKGVMRNDLNTRDTTLKSAGWNLNYLT
DNGWSLTTDLSYSSADRTDVIFESYSGTGPNGVGATDTLGFTTTPGAGTMFASTLDYTDR
NQFKLTDPQGWGGGASGGALTQAGFYNTPSITDELTAARFTAKRDLEWGPVKSVEFGLNA
SRREKDKEVHESFLTFGGRIAAGAPTSRAIPQEAIIGVAKLDLIGIKAMLAYDPTYLLKN
GFYTLIADANPAVQTRNWSVREDVQVAYAKFGVDSQVGSIPVTGNFGLQVVRTDQFSKGV
AVNPSAPASPTVTDDGAKYTYALPSLNLTFDAGNELYIRVGAARTLARARMDELRASQSF
NQNTSRLTSTDPNNSYFSANGGNPNLRPYIADGVDVAVEKYFGRSAYLSAAVYHKELSNF
VNSNSSSYKDFSDYLFLLSTAQQAQLGTKIGLVSGPDNGDGGYIRGLELSASLQGELLWE
PLKSFGLIISGSFTDSKVTLEKGTNPITIPGLSKTVVNTTFYYEKNGFNARISNRYRGKF
LGEVAGLSAARVFRTVDKESVVDAQIGYEFRDGPMNGLSLLLQANNITNEPFKTYDNNDQ
RQTIDYQKYGATYMVGVSYRF
NT seq 2766 nt   +upstreamnt  +downstreamnt
atgaacacccaattttcgcgccgtcgcgcctggctgatggccggcggggccacgggcctc
gcgctcgccttcgccgtcgccggttcggctcaggcccagaccaccacgaccgctgcggat
gacaccaaggtcgaggaagtcgtcatcaccggcattcgcgccggcctcgaaaactcgatc
gcgcttaagaagcaatcgacctcgatcgtcgaagccatttcggccgaagacatcggcaag
ctgccggacacctcgatcgccgagtcgctggctcgcctgcccggcctgaccgcccagcgc
ctcgacggccgcgcccaggtcatctcgatccgcggccttggcccggacttcacctcgacc
ctgctgaacggtcgcgaacaggtttcgaccggcgacaaccgcggcgtcgagttcgaccag
tatccgtcggaaatcctctcgggcgtggtggtctacaagaccccggacgccggcctgatc
ggccagggcctgtcgggcaccgccgacctgcgcacgatccgcccgctgacctacggcaag
cgcatcctgtcggctaacgctcgctatgaaatgaacagcgaaaagaagctgaacccggac
gccaaggacacggggcaccgcttcagcgccacctacgtcaaccagttcgcgaacgacacg
gttggcctggcactggccatttcggacatctcgaccccgacccagagcaagcgcttcaac
gcctggggctatccgaccatcaacgcggccaatgatcgcgtgatcggcggcgccaagccc
tacatccagtcgaacaacctcgagcgtttcggcgccatcggcgtcctcgagtacaagccg
aacgacaaggtcacgacctcgctggacgtctactactcggagttccaggaagagcagatc
ctgcgtggcatcgagctgccgctgcaatggtcgtccgcgacgctgcagccgacgcgcacc
accaccgccggcctgatcaccaacggcaccttctcgggcgtcaagggcgtgatgcgcaac
gacctgaacacgcgcgacaccaccctgaagtcggccggctggaacctgaactacctgacc
gacaatggttggtcgctgacgacggacctgagctactcctcggccgaccgcactgacgtg
atcttcgagtcctactcgggcaccggcccgaacggcgtcggcgcgaccgacaccctgggc
ttcacgaccacgccgggcgcgggcacgatgttcgcctcgaccctcgactacaccgaccgc
aaccagttcaagctgaccgacccgcagggttggggcggcggcgcctccggcggcgctctg
acccaggccggcttctacaacaccccgtcgatcaccgacgaactgacggccgcccggttc
accgccaagcgcgacctggagtggggtccggtcaagtcggtcgagttcggtctgaacgcc
agccgtcgcgagaaggacaaggaagtccacgaaagcttcctgaccttcggcggccgtatt
gctgccggcgccccgaccagccgcgccatcccgcaggaagccatcatcggcgtcgccaag
ctggacctgatcggcatcaaggccatgctggcctatgacccgacctatctgctgaagaac
ggcttctacaccctgatcgccgacgcaaacccggccgtgcagacccgcaactggtctgtc
cgtgaagacgtgcaggtggcctacgccaagttcggcgtcgactcccaggtcggctcgatc
ccggtgaccggcaacttcggcctgcaggtggttcgcaccgaccagttctcgaagggcgtc
gcggtcaacccgtccgcgccggccagcccgacggtcaccgacgacggcgccaagtacacg
tacgccctgccgagcctcaacctgacgttcgacgcaggcaacgagctgtacatccgcgtc
ggcgcggcccgcaccctggcccgggcccggatggacgaactgcgcgccagccagtcgttc
aaccagaatacctcgcgcctgacctcgacggatccgaacaactcgtacttcagcgctaac
ggcggcaacccgaacctgcgcccctacatcgccgacggcgtcgatgtggcggtggagaag
tatttcggtcgctcggcctacctgtcggccgccgtgtaccacaaggagctgtcgaacttc
gtcaactccaactcctcgtcctacaaggacttctcggactacctgttcctgctgagcacc
gcgcagcaggcgcagctcggcaccaagatcggcctggtctcgggccccgacaacggcgac
ggcggctacatccgcggtctggaactgtcggcctcgctgcagggcgaactgctgtgggaa
ccgctgaagtccttcggcctgatcatcagcggctcgttcaccgacagcaaggtgacgctg
gaaaagggcaccaacccgatcaccatcccgggtctgtccaagacggtcgtcaacaccacg
ttctactatgaaaagaacggcttcaacgcccggatcagcaaccgctatcgcggcaagttc
ctgggtgaagtcgccggcctgagcgccgcgcgcgtcttccgcacggtcgacaaggagtcg
gttgtcgacgcccagatcggctacgaattccgcgacggcccgatgaacggtttgtccctg
ctgctgcaggccaacaacatcaccaacgagcccttcaagacctacgacaacaacgatcag
cgccagaccatcgactatcagaagtatggcgcgacctacatggtcggcgtgtcgtaccgc
ttctaa

DBGET integrated database retrieval system