KEGG   Chondromyces crocatus: CMC5_004610Help
Entry
CMC5_004610       CDS       T04010                                 

Definition
(GenBank) uncharacterized protein
  KO
K01208  cyclomaltodextrinase / maltogenic alpha-amylase / neopullulanase [EC:3.2.1.54 3.2.1.133 3.2.1.135]
Organism
ccro  Chondromyces crocatus
Pathway
ccro00500  Starch and sucrose metabolism
ccro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CMC5_004610
Enzymes [BR:ccro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.54  cyclomaltodextrinase
     CMC5_004610
    3.2.1.133  glucan 1,4-alpha-maltohydrolase
     CMC5_004610
    3.2.1.135  neopullulanase
     CMC5_004610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Radical_SAM SPASM AMPK1_CBM Fer4_12
Motif
Other DBs
NCBI-ProteinID: AKT36348
UniProt: A0A0K1E6Z4
Position
complement(611455..614601)
Genome map
AA seq 1048 aa AA seqDB search
MPRHLVPLHLPDEGLLLFQHRPSRPVPFLDLRGDLTHWYHADPMHPAADGRFEVGVRVGT
GIYGYKFNLIDGTWETDPRNPRTRAVDGIQNSVLSVGGAAEPVLHAPARPWLARTDDGRL
IVRAGLRRGHGDGLRVRWDEGDGLRLAPMVLAAEEDEHLLLEAHLPASARHVEYAFLLDD
GRYVGREGGAGQAFRVAPRALAAAPPAWWRDAVLYTVFVDRFRRGGTGGTWPIALAHERD
RLGGDLDGLLEGLDHLVDLGVTALHLTPLSTSPSAHRYDAIDPRATDPALGGDDAFVRLL
DQAHRRGLKVLVDLALTHVHRDFFAFADVRARGPESPYWHWFRAHRWPFFDGQDPGYAHY
QKENWHLPLLETAHEEVLDYLAAACTRWVELGADGIRIDAAADLPFAAVRHLAREVRAVR
PDVALFGEVIPDNLHRWTGGLLDAATDFGAQQALDDWLVHGRGAERARQILLRRRFFRGG
PGHSSIAFTATHDQSRLLTRLRDPEATRLGHLLVLLRAAIPALYYGDEIGLAGPPGERAF
EDAWPDRLPMEWDRSRWDHDTLDLVRRALHLRRETRALREGDELFLPADFPPDPPAALPP
ADPLAPPGEHPSTDDAPADGLLILRRVAGAEIVDILLNADRTPVQVPLPAGAPSGAEPLL
VQGDAAVDPERGLVHLGPRAAIVLRRVLPRDLGALATELLRTSPRRAVAAFKQGDLAPFT
LPARLYLTVTERCNLRCRHCITTAPGRTADGTARTLKPWLLDALAEAFAAATYVGFVHGG
ESLTAPLFPDVLRAIQRARSGQPTDVHLLTNGMLLDGDMARRLIDLGVTSLAFSLDGATA
ETNDTLRAGGQLDRILQNLRDTLAARRALGADLRVGISTVVTRSALDELPALGHLARDLG
VDWLKVEEIVPSTPLAARELLAPRASRVEAAVAALREALTGSPVVLVDHRDPPGGCACEA
RGKPELRAFREADDYANRTRLDACRMAWEQAAIDPDGTVRPVDYEQPPLGNLLEHTLLEL
WNGEAMQRVRAEALTRIPRARRTNCPML
NT seq 3147 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcgccacctcgtccctctgcacctgcccgacgaagggctcttgctcttccagcac
cgcccctctcgccccgtcccgttcctcgacctgcgcggcgacctcacccactggtatcac
gccgacccgatgcacccggccgccgacggccgcttcgaggtcggcgtccgcgtcggcacc
ggcatctacggctacaagttcaacctcatcgacggcacctgggagacggacccccggaac
ccgcgcacccgcgccgtcgacggcatccagaacagcgtcctctccgtcggcggcgctgcc
gagcccgtgctccacgcccctgcgcgaccctggctcgcgcgcaccgacgacggccgcctg
atcgtccgcgccggcctccgccgcggccacggcgacggcctgcgcgtccgctgggacgaa
ggcgacggcctccgcctcgcccccatggtcctggccgccgaggaagacgagcacctcctg
ctcgaagcccacctccccgcctccgcccgccacgtcgagtacgccttcctcctcgacgac
ggccgctacgtcggccgcgaaggcggcgccggccaggcgtttcgcgtggccccccgcgcg
ctcgccgctgcgccgcctgcgtggtggcgtgacgccgtgctctacaccgtgttcgtcgat
cgcttccggcgcggcggcaccggcggcacctggcccattgccctcgcccacgagcgcgac
cgcctcggcggcgacctcgacggcctcctcgaaggcctcgaccaccttgtcgacctcggc
gtcaccgccctgcacctcacccctctctccacctccccctccgcccaccgctacgacgcc
atcgacccacgcgccaccgaccccgccctcggcggcgacgacgccttcgtgcgcctcctc
gaccaggcacaccgccgcggcctcaaggtcctcgtcgacctcgccctcacgcacgtccac
cgcgacttcttcgccttcgccgacgtccgcgcgcggggccccgagtccccctactggcac
tggttccgcgcccaccgctggcccttcttcgacggccaggaccccggctacgcccactac
cagaaggaaaactggcacctccccctcctcgagaccgcccacgaagaggtcctcgactac
ctcgccgctgcctgcacccgctgggtcgaactcggcgccgacggcatccgcatcgacgcc
gccgccgacctccccttcgccgccgtccgccacctcgcccgcgaagtccgcgccgtccgc
cccgacgtcgccctcttcggcgaggtcatccccgacaacctccaccgctggaccggcggc
ctgctcgacgccgccaccgacttcggcgcccagcaagccctcgacgactggctggtgcac
ggccgcggcgccgagcgcgcccgccagatcctcctgcggcgccgcttctttcgcggcgga
cccggccactcctccatcgccttcaccgccacccacgaccagtctcgcctcctcacccgc
ctccgcgaccccgaagccacccgcctcggccacctcctcgtcctcctccgcgccgccatc
cccgccctgtattacggcgacgagatcggcctcgccggccctcctggcgagcgcgccttc
gaggacgcctggcccgaccgcctccccatggagtgggatcgctcccgctgggaccacgac
accctcgacctggtccgtcgcgccctccacctccgccgcgagacccgcgccctccgcgaa
ggcgacgagctgttcctccccgccgacttcccccccgatccccccgccgcgctccctccc
gccgaccccctcgcgcctcccggggagcacccctccaccgacgacgcacctgccgacggc
ctcctcatcctccgccgcgtcgctggcgccgagatcgtcgacatcctcctcaacgccgac
cgcaccccggtccaggtccccctccctgcgggggccccttccggcgccgagcccctcctc
gtccagggcgacgccgccgtcgaccccgagcgcggcctcgtccacctcggcccccgcgcc
gccatcgtcctccgccgcgtcctccccagagacctcggcgccctcgccaccgagctgctc
cgcaccagcccacgccgcgccgtcgccgccttcaagcaaggcgacctcgcccccttcacc
ctccccgcgcgcctctacctcaccgtcaccgagcgctgcaacctccgctgccgccactgc
atcaccaccgcccccggaaggaccgcggacggcaccgcgcgcaccctgaaaccctggctc
ctcgacgccctcgccgaggccttcgccgccgccacctacgtcggcttcgtccatggcggc
gagtccctcaccgcccccctcttccccgacgtcctccgcgccatccagcgcgcccggagc
ggccagcccaccgacgtccacctcctcacgaacggcatgctcctcgacggcgacatggcc
cgacgcctcatcgacctcggcgtcaccagcctcgccttctccctcgacggcgccaccgcc
gagaccaacgacacccttcgcgccggcggccagctcgaccgcatcctccagaacctccgc
gacaccctcgccgcccgccgcgccctcggcgccgaccttcgcgtcggcatctccaccgtc
gtcacccgcagcgccctcgacgaactccccgccctcggccacctcgcccgggacctcggc
gtcgactggctcaaggtcgaagagatcgtcccctccacccccctcgccgcccgcgagctg
ctcgccccccgcgcctcccgcgtcgaggccgccgtcgccgccctccgcgaggccctcacg
ggctctccggtcgtactcgtggaccaccgcgaccccccgggcggctgcgcctgcgaggcc
cgcggcaaacccgagctacgcgccttccgcgaggccgacgactacgccaaccggacgcgc
ctcgacgcctgccgcatggcctgggagcaagccgccatcgaccccgacgggaccgtgcgt
cccgtcgattacgagcagccgcccctcggcaacctcctggagcacaccctcctcgaactg
tggaacggcgaggccatgcagcgggtgcgcgccgaagcgctgacccgcatcccccgcgcc
cggcggacgaactgcccgatgctgtag

DBGET integrated database retrieval system