KEGG   Chondromyces crocatus: CMC5_029210Help
Entry
CMC5_029210       CDS       T04010                                 

Definition
(GenBank) succinyl-CoA:3-ketoacid-CoA transferase
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
ccro  Chondromyces crocatus
Pathway
ccro00072  Synthesis and degradation of ketone bodies
ccro00280  Valine, leucine and isoleucine degradation
ccro00650  Butanoate metabolism
ccro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CMC5_029210
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    CMC5_029210
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CMC5_029210
Enzymes [BR:ccro01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     CMC5_029210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AKT38775
UniProt: A0A0K1ED24
Position
complement(3848556..3849305)
Genome map
AA seq 249 aa AA seqDB search
MDKVYKSAIDAVRDIPAGATILAGGFGLCGIPENCIRALRELGTSNLVVVSNNCGVDDFG
LGILLRNRQIRKMISSYVGENKEFERQYLTGELEVELTPQGTLAERIRAGGAGIPAFYTP
TGAGTAISEGGLPVLYDADGSVKQYSEKKETRTFDGREYVLEPAITGDFAIVKAWKGDRY
GNLVYRHTAMNFNPMMATAGRVTIAEVEELVPVGSLDPNHIHTPGIFVHRVVQGEGYEKR
IERRTVQKA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtctacaagagcgccatcgacgcagtgcgggacatccccgctggcgcgacg
atcctggcgggcgggttcgggctgtgcgggatcccggagaactgcatccgcgcgctgcgc
gagctcggcacgagcaacctcgtggtggtctcgaacaactgcggcgtcgacgacttcggg
ctgggcatcctcctgcgcaaccggcagatccggaagatgatctcgtcgtacgtgggcgag
aacaaggagttcgagcgccagtacctcaccggggagctcgaggtggaactgacgccccag
gggacgctcgcggaacgcatccgcgcaggtggcgccgggatccccgcgttttacacaccg
acgggcgccgggacggcgatcagcgaggggggcctccccgtgctgtacgacgccgacggg
tcggtgaagcagtactcggagaagaaggaaacccgcaccttcgacggccgtgagtacgtg
ctggagcccgccatcaccggcgacttcgccatcgtcaaggcgtggaagggggatcgctac
ggcaacctcgtctaccggcacaccgcgatgaacttcaacccgatgatggcgacggcgggg
cgcgtgacgatcgccgaggtcgaggagctggtcccggtcggctcgctggacccgaaccac
atccacacgcccgggatcttcgtgcaccgcgtcgtccaaggcgagggatacgagaagcgg
atcgagcggcgcacggtccagaaagcctga

DBGET integrated database retrieval system