KEGG   Chondromyces crocatus: CMC5_029620Help
Entry
CMC5_029620       CDS       T04010                                 

Definition
(GenBank) amino acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ccro  Chondromyces crocatus
Pathway
ccro00350  Tyrosine metabolism
ccro00360  Phenylalanine metabolism
ccro00380  Tryptophan metabolism
ccro01100  Metabolic pathways
ccro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CMC5_029620
   00360 Phenylalanine metabolism
    CMC5_029620
   00380 Tryptophan metabolism
    CMC5_029620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccro04147]
    CMC5_029620
Enzymes [BR:ccro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     CMC5_029620
    4.1.1.105  L-tryptophan decarboxylase
     CMC5_029620
Exosome [BR:ccro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CMC5_029620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC SepSecS Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKT38816
UniProt: A0A0K1ED61
Position
3901444..3902946
Genome map
AA seq 500 aa AA seqDB search
MTDASRLHEAQRGLGDMSPADFRDAGARVVDQVASYLARLETLPILPPIQPGDIRRQFPS
GPPLAPEPIEQILDDYSRLIEPNITHWQHPGFMAYFASVASGPGILGEWLAAGLNSNVMF
WRNAPASTEVEEVTVDWLRQLFGLPAVFDGMFTDTASVSSLLAVVAARHAVPGLDARDEG
LAGRPELGRLRIYCSTETHSSVEKAAIVAGVGRAGVRRVPVDDDFRMRPELLAEAIREDR
AAGWLPFCVVATIGTTSSTSIDPVPAIAAICREERLWLHVDAAYGGAAAVVPEMRPLFEG
WELADSIVVNPHKWLFTPFDASLLLFRSPEVFRDAFSLVPEYLRVKREGEAHDYHEYGIQ
LGRRFRALKLWMLIRYFGADGLAARVREHCRMAQELSGWVDAEPGFERVAPTPFSTVCLR
HVPAELAGREEDADAQQKIDALNEAILERVNRSGQIFLSHTRLRGRYTIRVTLGNPRQTM
EHVHRCWTLLKEAASSASSG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcctcccggctgcacgaggcccaacgcgggctcggtgacatgagccccgcc
gacttccgtgacgctggcgcgcgcgtggtcgatcaggtcgccagctacctcgcgcgcctc
gagaccttgccgatcctgccgcccatccagcccggagacatccggcgacagtttccctcg
ggtccccctctcgcgcccgagcccatcgagcagatcctcgacgattattcccggctcatc
gagccgaacatcacccactggcagcacccgggtttcatggcctacttcgcctcggtggca
tccggcccgggcatcctcggagagtggctcgctgcagggctgaactccaacgtgatgttc
tggcgcaacgcgcctgcatcgaccgaggtggaggaggtgaccgtcgactggctccggcag
ctcttcggcttgcctgcggtcttcgacgggatgttcacggacaccgcctcggtctcgtcc
ttgctcgcggtcgtcgccgcacggcacgcggtcccgggcctcgacgcgcgcgacgagggg
ctcgcgggccggcccgagctgggccgcttgcggatctactgctccacggagacccactcc
tccgtcgagaaggccgccatcgtcgccggtgtcggccgcgctggcgtgcgccgcgtcccg
gtcgacgacgatttccgcatgcgtcccgagcttctcgcggaggcgatccgcgaagaccgc
gctgcggggtggctcccgttctgtgtcgtcgccaccatcgggaccacctcctccacgagc
atcgacccggtccccgcgatcgccgccatctgccgggaagagcgcctctggctccacgtc
gacgcggcctacggtggcgctgcggcggtggtccccgagatgcggccgctgttcgagggc
tgggagctcgccgactcgatcgtggtgaacccacacaagtggttgttcacaccgttcgac
gcctccttgctcctgttccgctcgccagaggtgtttcgcgacgccttcagcctcgtcccc
gagtacctccgggtgaagcgggagggggaggcgcacgactaccacgagtacggcatccag
ctcggtcggcggttccgcgcgctgaagctgtggatgctgatccgctacttcggcgccgac
ggcctcgccgcgcgtgtgcgcgagcactgtcggatggcgcaggagctgtcggggtgggtg
gacgccgagcccggcttcgagcgggtcgcgccgacgccgttctcgaccgtctgcttgcgc
catgtcccggccgagctggcaggacgggaagaggatgccgacgcgcagcaaaaaatcgac
gccctgaacgaggccatcctggagcgagtgaaccggagcgggcagatctttctgtcgcat
acccgcctgcgcggccggtacacgatccgcgtcaccctggggaacccgaggcagaccatg
gagcacgtccatcgctgctggaccttgctgaaggaagccgcctcgagcgcctcgtcgggc
tag

DBGET integrated database retrieval system