KEGG   Chondromyces crocatus: CMC5_078590Help
Entry
CMC5_078590       CDS       T04010                                 

Definition
(GenBank) aldehyde dismutase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ccro  Chondromyces crocatus
Pathway
ccro00625  Chloroalkane and chloroalkene degradation
ccro00680  Methane metabolism
ccro01100  Metabolic pathways
ccro01120  Microbial metabolism in diverse environments
ccro01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccro00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    CMC5_078590
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CMC5_078590
Enzymes [BR:ccro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     CMC5_078590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N AlaDh_PNT_C ADH_zinc_N HI0933_like 2-Hacid_dh_C Nitro_FeMo-Co
Motif
Other DBs
NCBI-ProteinID: AKT43624
UniProt: A0A0K1ES59
Position
10605246..10606439
Genome map
AA seq 397 aa AA seqDB search
MASNRGVVYLGPGKVEVQSIEYPKFVDPRGKAIEHGVILKVVSTNICGSDQHMVRGRTTA
PTGLVLGHEITGEVVEMGKDVEYLSKGDLVTVPFNVACGRCRTCREQQTGVCLNVNDARA
GGAYGYVDMGGWVGGQAEYVMVPYADFNLIKFPDKARAMEKIRDLTMLSDILPTGFHGAV
TAGVGVGSTVYVAGAGPVGLAAAASAQILGAAVVLVGDMNQERLKHAKSVGFEPIDLTKS
DKLEELIEAVLGEPEVDASIDAVGFEARGHGSQAGTEAPATVLNALMTVTRASGGIGIPG
LYVTEDPGSKDEAAQHGNLRMRLGLGWAKSHRFYTGQTPVLQYNRQLMQAILYDRLPIAK
VVNATVIPLSEAAKGYKDFDAGVAKKFVLDPHGMLTG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaatcgtggcgtggtctatctggggccgggcaaggtggaggtgcagtccatc
gaatacccgaagttcgtggacccgcgggggaaggccatcgagcacggggtcatcctgaag
gtggtctccacgaacatctgcggatcggatcagcacatggtccggggacggacgacggcg
ccgacagggctcgtgctggggcacgagatcacgggcgaggtcgtggagatgggcaaggac
gtggagtacctgtcgaagggcgatctggtgacggtgccgttcaacgtggcctgcggccgc
tgtcgcacctgccgggaacagcagacgggcgtgtgcctgaacgtgaacgacgcgcgcgcc
ggcggtgcgtacggctatgtcgacatggggggctgggtcggcggacaggccgagtacgtg
atggtcccctatgccgacttcaacctgatcaagttccccgacaaggcgcgggcgatggag
aagatccgggacctgacgatgctgtcggacatcctgcccacgggctttcacggggcggtg
acggcaggggtcggcgtggggtcgacggtgtacgtggccggcgcggggccggtggggctc
gcggcggcggcgtcggcgcagatcctgggggccgcggtcgtgctggtcggggacatgaac
caggagcggctgaagcacgcgaagtcggtgggcttcgagccgatcgacctgacgaagagc
gacaagctggaggagctgatcgaggccgtgctcggagagcccgaggtggatgcatcgatc
gatgccgtggggttcgaagcgcgcgggcacgggtcccaggcgggcacggaggcgccagcg
acggtgctgaatgcgctgatgacggtgacgcgcgcgagcggtgggatcgggatcccgggg
ctctacgtgacggaggatccgggctcgaaggacgaggcggcgcagcacggaaacctgcgc
atgcggctgggactcggctgggcgaagtcgcaccgcttctacacggggcagacgccggtg
cttcagtacaaccggcagctcatgcaggcgattctctatgaccggctgccgattgcaaag
gtggtgaatgcaacggtgattccgctgtcggaggcagcgaaggggtacaaggacttcgac
gcgggggtggcgaagaagttcgtgctcgacccgcacgggatgctgactggatag

DBGET integrated database retrieval system