KEGG   Chondromyces crocatus: CMC5_080140Help
Entry
CMC5_080140       CDS       T04010                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccro  Chondromyces crocatus
Pathway
ccro00071  Fatty acid degradation
ccro00072  Synthesis and degradation of ketone bodies
ccro00280  Valine, leucine and isoleucine degradation
ccro00310  Lysine degradation
ccro00362  Benzoate degradation
ccro00380  Tryptophan metabolism
ccro00620  Pyruvate metabolism
ccro00630  Glyoxylate and dicarboxylate metabolism
ccro00640  Propanoate metabolism
ccro00650  Butanoate metabolism
ccro00900  Terpenoid backbone biosynthesis
ccro01100  Metabolic pathways
ccro01110  Biosynthesis of secondary metabolites
ccro01120  Microbial metabolism in diverse environments
ccro01130  Biosynthesis of antibiotics
ccro01200  Carbon metabolism
ccro01212  Fatty acid metabolism
ccro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ccro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CMC5_080140 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    CMC5_080140 (atoB)
   00640 Propanoate metabolism
    CMC5_080140 (atoB)
   00650 Butanoate metabolism
    CMC5_080140 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CMC5_080140 (atoB)
   00072 Synthesis and degradation of ketone bodies
    CMC5_080140 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CMC5_080140 (atoB)
   00310 Lysine degradation
    CMC5_080140 (atoB)
   00380 Tryptophan metabolism
    CMC5_080140 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CMC5_080140 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CMC5_080140 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CMC5_080140 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccro04147]
    CMC5_080140 (atoB)
Enzymes [BR:ccro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CMC5_080140 (atoB)
Exosome [BR:ccro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CMC5_080140 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: AKT43778
UniProt: A0A0K1ET25
Position
10796347..10797531
Genome map
AA seq 394 aa AA seqDB search
MTLPVPVYIVAATRTPIGAFQGALSSLTAPRLGAAAIEAALQRANLPADAIEEVFMGNVL
SAGIGQAPARQAAIFAGIPDKVPATTINKVCGSGLQAVVFGAKTIALGDADLVVAGGMES
MSNVPYYLPQARTGYRMGNNSVVDGMIHDGLWDPYGNFHMGVAGDKCAKEHGFSREAQDE
YAKESFRRALAAQKEGQFDAEIVPVSVPQKKGDPVVVKLDDGPGAGKPDKFASLRPAFQK
DGTVTAANASSINDGASALILASEKAVKERGLTPLGRILGYGGAAQAPEWFTTAPAAAIA
NTTKKLGITTEQIDLYEVNEAFAVVAMAVNKLSNLDPQKVNVRGGAVALGHPIGASGARV
LTTLLYTLKDQNKKRGLATLCIGGGEALALVVER
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcccgtccccgtgtacatcgtcgccgccacccgtacgcccatcggcgcgttc
cagggtgcgctctcctcgctgacggcaccgcgcctcggcgccgcggccatcgaggcggcg
ctccagcgcgccaacctccccgccgacgccatcgaggaggtgttcatggggaacgtgctc
tcggccgggatcggccaggcgcccgcgcgccaggccgcgatcttcgccgggatcccggac
aaggtgcccgcaacgacgatcaacaaggtgtgtggctcgggcctgcaggcggtggtcttc
ggggcgaagacgatcgcgctgggcgacgcggacctggtggtggccggcggcatggagtcg
atgtcgaacgtgccgtactacctgccgcaggcgcggacgggctaccggatggggaacaac
tcggtcgtggacgggatgatccacgatggcctgtgggacccgtacgggaacttccacatg
ggcgtcgccggcgacaagtgcgcgaaggagcacgggttcagccgcgaggcgcaggacgag
tacgcgaaggagagcttccgccgggcgctggccgcgcagaaagaggggcagttcgacgcg
gagatcgtgccggtgagcgtgccgcagaagaagggcgatccggtcgtggtgaagctcgac
gacggtccgggcgcgggcaagcccgacaagttcgcgtcgctccggccggcgttccagaag
gacgggacggtgacggcggcgaacgcttcgtcgatcaacgacggcgcgagcgcgctgatc
ctggcgagcgagaaggcggtgaaggagcgggggctgacgccgctcgggcggatcctgggc
tacggtggcgcggcgcaggcgccggagtggttcaccacggcgccggccgcggcgatcgcg
aacacgacgaagaagctcggcatcaccacggagcagatcgatctgtacgaggtgaacgag
gcgttcgcggtggtggcgatggccgtgaacaagctgagcaacctcgacccgcagaaggtg
aacgtgcgcggcggggcggtggcgctcggtcaccccatcggcgcgagcggcgcgcgcgtg
ctgacgacgctgctctacacgctgaaggaccagaacaagaagcggggcctggcgacgctg
tgcatcggcggcggcgaggccctggcgctggtggtcgagcgatga

DBGET integrated database retrieval system