KEGG   Caulobacter vibrioides NA1000: CCNA_00340Help
Entry
CCNA_00340        CDS       T00841                                 

Definition
(RefSeq) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs00020  Citrate cycle (TCA cycle)
ccs00640  Propanoate metabolism
ccs00660  C5-Branched dibasic acid metabolism
ccs01100  Metabolic pathways
ccs01110  Biosynthesis of secondary metabolites
ccs01120  Microbial metabolism in diverse environments
ccs01130  Biosynthesis of antibiotics
ccs01200  Carbon metabolism
Module
ccs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ccs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCNA_00340
   00640 Propanoate metabolism
    CCNA_00340
   00660 C5-Branched dibasic acid metabolism
    CCNA_00340
Enzymes [BR:ccs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CCNA_00340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-GeneID: 7331039
NCBI-ProteinID: YP_002515715
UniProt: B8GYZ1
Position
352434..353633
Genome map
AA seq 399 aa AA seqDB search
MNIHEHQAKAVLAEFGAPVPRGFAAFTPDEAAAAAEKLGGPVFVVKSQIHAGGRGKGKFE
GLGPDAKGGVRVVKSVEEVRSNAEEMLGRVLVTHQTGPKGKQVNRLYIEEGAAIAKEFYL
SLLVDRASSKVSVVASTEGGMDIEDVAHSTPEKIHTFTIDPATGVWPTHHRALAKALGLT
GGLAKEAASLLNQLYTAFMAKDMAMLEINPLIVTADDHLRVLDAKLSFDGNSLFRHPDIK
ALRDESEEDPKEIEASKYDLAYIALDGEIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITADPAVKGILVNIFGGIMRCDIIAEGVIAAVKEVGLQVPLVVRLE
GTNVELGKKIISESGLNVIAANDLSDGAEKIVAAVKGAR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaacatcaagccaaagctgtactcgccgagttcggcgcccccgtgccg
cgcggcttcgccgccttcacgcccgatgaagccgccgccgccgccgaaaagctgggtggg
ccggtcttcgtcgtgaagagccagatccacgccggtggccgtggtaagggcaagttcgag
ggcctgggccccgacgccaagggcggcgtccgcgtcgtcaagtcggtggaagaggttcgc
tcgaacgccgaggaaatgctgggccgcgtccttgtgacgcaccagaccggcccgaagggc
aagcaggtcaaccgcctctacatcgaagaaggcgcggcgatcgccaaggaattctacctg
tcgctgctggttgaccgcgcctcgagcaaggtctcggtcgtcgcctcgaccgaaggcggc
atggacatcgaggacgtcgcccactcgacgcccgagaagatccacaccttcaccatcgac
ccggcgacgggcgtgtggccgacgcatcaccgcgccctggccaaggctctgggcctgacc
ggcggtctggccaaggaagccgcctcgctgctgaaccagctctatacggcgttcatggcc
aaggacatggccatgctggagatcaacccgctgatcgtgacggcggatgatcacctgcgc
gtcctggacgccaagctgtcgttcgacggcaacagcctgttccgtcacccggacatcaag
gcgctgcgcgacgagagcgaagaagaccccaaggaaatcgaagcgtcgaagtacgacctg
gcctacatcgccctcgacggcgaaatcggctgcatggtcaacggcgccggtctggccatg
gccaccatggacatcatcaagctgtacggcgccgagccggccaacttcctggatgtcggc
ggcggcgccagcaaggagaaggtcaccgcagccttcaagatcatcaccgccgatccggcc
gtcaaaggcatcctggtcaacatcttcggcggcatcatgcgctgcgacatcatcgccgaa
ggcgtgatcgccgcggtgaaggaagtcggtctccaggttccgctggtcgtccgtctggaa
ggcaccaacgtcgaactcggcaagaaaatcatctcggaaagcggcctgaacgtcatcgcc
gccaacgatctgtctgacggcgccgagaagatcgtcgccgctgtgaagggcgcccgctaa

DBGET integrated database retrieval system