KEGG   Caulobacter vibrioides NA1000: CCNA_00657Help
Entry
CCNA_00657        CDS       T00841                                 

Definition
(RefSeq) type I restriction-modification system specificity subunit
  KO
K01154  type I restriction enzyme, S subunit [EC:3.1.21.3]
Organism
ccs  Caulobacter vibrioides NA1000
Brite
Enzymes [BR:ccs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     CCNA_00657
Prokaryotic defense system [BR:ccs02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   CCNA_00657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methylase_S
Motif
Other DBs
NCBI-GeneID: 7330463
NCBI-ProteinID: YP_002516030
UniProt: A0A0H3C7H7
Position
712528..713880
Genome map
AA seq 450 aa AA seqDB search
MSFPAYESYKESGVEWLGRVPSHWNFRPLKHLVIMRSGGTPSKEREDYWGGEIPWASAKD
LKVDTLTDTQDHLTAEALDEGAAQLLPANAVVVLVRGMMLARTFPVCRLSRPMTINQDLK
GLIANRGVDPNYLAWSLRASEVETLCRLDEAGHGTKALRMDAWSTMELPAPSLAEQQAIA
AFLDRETAKIDALVEAQERLIALLKEKRQAVISHAVTKGLDPSAQMKDSGVEWLGQMPAH
WEVVPAKNLADSIKAGPFGSALTKDMYSSAGYRVYGQEQVIPGDFRIGDYYVTSDRYNEL
SQYRVEVGDLLVSCVGTFGKIAIFPQGAEPGIINPRLIRFRPNNQVDPTYLCVLLRSAVS
FEQFSYLSRGGTMDVINIGILGEIVVPVPPMQEQISIAGYLAEVQEQFDSLSAASEAAIT
LLQERRAALISAAVTGKIDVRGLVQTAEAA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgagctttccggcttatgagagctataaggagagtggggtcgagtggctcgggcgggtg
ccgagccattggaattttcggccgctaaagcacctcgtaatcatgcggagcggcggcacg
ccaagcaaggaacgagaagactattgggggggagaaattccttgggcatcggccaaggac
ctaaaggtcgacaccctgaccgatactcaggaccaccttacggcggaagctctcgatgaa
ggtgctgctcagcttctccccgctaacgccgtcgtggtgctcgttcgcgggatgatgctc
gcccggactttcccagtttgtagattgtcgcggccaatgacgatcaaccaagacctgaag
gggctcatagctaaccggggcgttgaccccaactatctggcttggtcgcttcgggcatca
gaagtcgagactctttgccggctcgatgaagccggacacggcaccaaagcgctaaggatg
gacgcctggtccacaatggaattgcctgcgccgtctttggcggagcagcaggccatcgcc
gccttccttgaccgggagaccgccaagatcgacgcgctggtggaggcgcaggagcggctg
atcgcgctgctgaaggagaagcgacaggccgtcatctcccacgccgtcaccaaggggctc
gacccgtccgcccagatgaaggacagcggcgtcgaatggctcggccagatgccggcgcat
tgggaggtggtgcccgccaagaacctcgccgacagcataaaagccgggccatttggctca
gcgctcactaaagatatgtattcaagcgccggataccgcgtctatggccaagaacaagtt
ataccaggagactttagaatcggcgactactacgtaacgagcgatagatacaatgaactt
tctcagtatcgcgtcgaggtcggcgaccttcttgttagctgcgtaggaacattcgggaag
atcgcaattttcccgcagggggcagagcccgggatcatcaatccgcggctaatacgcttt
aggccgaacaatcaggtcgatccgacatatttatgcgtcctgctccgaagcgcagtttcg
ttcgagcagttttcgtatctcagccgcggaggcacgatggacgtaatcaacatcggcatc
ctcggcgagattgtggttccagttccgcctatgcaggaacaaatcagtatcgccggttat
ctcgccgaggttcaggagcagtttgacagcctctccgccgcctcggaagccgccatcacc
ctccttcaagaacgccgcgccgccctgatctccgccgccgtcaccggcaagatcgacgtg
cggggcctcgtccagacagcggaggccgcatga

DBGET integrated database retrieval system