KEGG   Caulobacter vibrioides NA1000: CCNA_00820Help
Entry
CCNA_00820        CDS       T00841                                 

Definition
(RefSeq) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs00071  Fatty acid degradation
ccs00072  Synthesis and degradation of ketone bodies
ccs00280  Valine, leucine and isoleucine degradation
ccs00310  Lysine degradation
ccs00362  Benzoate degradation
ccs00380  Tryptophan metabolism
ccs00620  Pyruvate metabolism
ccs00630  Glyoxylate and dicarboxylate metabolism
ccs00640  Propanoate metabolism
ccs00650  Butanoate metabolism
ccs00900  Terpenoid backbone biosynthesis
ccs01100  Metabolic pathways
ccs01110  Biosynthesis of secondary metabolites
ccs01120  Microbial metabolism in diverse environments
ccs01130  Biosynthesis of antibiotics
ccs01200  Carbon metabolism
ccs01212  Fatty acid metabolism
ccs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ccs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCNA_00820
   00630 Glyoxylate and dicarboxylate metabolism
    CCNA_00820
   00640 Propanoate metabolism
    CCNA_00820
   00650 Butanoate metabolism
    CCNA_00820
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCNA_00820
   00072 Synthesis and degradation of ketone bodies
    CCNA_00820
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCNA_00820
   00310 Lysine degradation
    CCNA_00820
   00380 Tryptophan metabolism
    CCNA_00820
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCNA_00820
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCNA_00820
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CCNA_00820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccs04147]
    CCNA_00820
Enzymes [BR:ccs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CCNA_00820
Exosome [BR:ccs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCNA_00820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-GeneID: 7329856
NCBI-ProteinID: YP_002516193
UniProt: A0A0H3C6D4
Position
complement(882223..883395)
Genome map
AA seq 390 aa AA seqDB search
MGEAYIVAAARTAGGRKGGRVSGWHPADLAGEVLNALVDRSGADPALIEDVIMGCVGQVG
EQAINIARNAVLASKLPESVPATSVDRQCGSSQQSIHFAAATVMSGAMDIVIAAGVESMS
RVPMGLSSALPYKNGFGTYKSPRMEERYPGIQFSQFAGAEMLAKKYDLSREQLDAFALAS
HQRAMAATKGGKFAAEIVPIKVTLPDGSVETHDADEGIRWDATMESIGGVKLLSEDGRLT
AATSSQICDGAAGVMIVNERGLKALGVAPLARIHHMTVIGHDPVIMLEAPIPATQKALER
AGMKIDDIDLYEVNEAFASVPTAWLQVTGGDPDKLNVNGGAIALGHPLGGSGAKLMTTLV
HALKDRGARYGLQTMCEGGGLANVTIVERL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaagcctatatcgtggcggccgcgcgcacggccggcggacgcaagggcggacgg
gtctcgggctggcatccggccgatctggcgggcgaggtgctgaacgccctggtcgaccgc
agcggcgccgatccggccctgatcgaggacgtgatcatgggctgcgtgggccaggtgggc
gagcaggccatcaacatcgcccgcaacgcggtgctggcctccaagctgcccgagagcgtg
cccgccacctcggtcgaccgtcagtgcggctcgtcccagcagtcgatccacttcgccgcc
gccaccgtgatgtcgggcgcgatggacatcgtcatcgccgccggcgtcgagagcatgagc
cgcgtgccgatgggcctgtcgtcggccctgccctacaagaacggttttggaacctacaag
agcccccgcatggaggagcgctatccggggatccagttcagccagttcgccggcgccgag
atgctggccaagaagtacgacctgtcgcgcgagcagctggacgccttcgctctggccagc
caccagcgcgccatggccgcgaccaagggcggcaagttcgccgccgagatcgtgccgatt
aaggtgaccctgcccgacggctcggttgagacccacgacgccgacgagggcatccgctgg
gacgccacgatggagtcgatcggcggcgtgaagctgctcagcgaagacggccgcctgacc
gccgccacctccagccagatctgcgacggcgcggcgggcgtgatgatcgtcaacgagcgg
ggtctgaaggccctcggcgtcgcgccgctggcccgcatccaccacatgaccgtcatcggc
catgacccggtgatcatgctggaggccccgatcccggccacccagaaggcgctggagcgg
gccggcatgaagatcgacgacatcgacctctacgaggtcaacgaggccttcgcctcggtg
ccgaccgcctggctgcaggtgaccggcggcgatccggacaagctgaacgtcaacggcggc
gccatcgccctcggccacccgctagggggttcaggcgccaagctgatgacgacgctggtc
cacgccctgaaggaccgcggcgcgcgctatggcctgcagaccatgtgcgaaggcggcggc
ctggcgaacgtgacgatcgtcgagcggctttga

DBGET integrated database retrieval system