KEGG   Caulobacter vibrioides NA1000: CCNA_01397Help
Entry
CCNA_01397        CDS       T00841                                 

Definition
(RefSeq) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs00900  Terpenoid backbone biosynthesis
ccs01100  Metabolic pathways
ccs01110  Biosynthesis of secondary metabolites
ccs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCNA_01397
Enzymes [BR:ccs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CCNA_01397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 7331855
NCBI-ProteinID: YP_002516770
UniProt: B8H510
Position
1516960..1517832
Genome map
AA seq 290 aa AA seqDB search
MRLSAFAPAKVNLFLHVGGPDGEGYHPISSLMVFADVGDRVNLQPADAPAFETSGPFGDQ
IPAGGDNLVVRAGQAFHRRLGGPVPPYRLILEKHLPIAAGLGGGSSDAGAALKLLRDALA
PALSDDDLEALAASLGADGAACLRARALIAEGRGERLSPAPRLPELNAVLVNPGAPSPTG
AVYRAYDAGVHPDGAAMPPMPDHLESAEEAAAWLAFATRNDLEAPAVRLEPHIGEVLDVL
RGEPESLLVRMSGSGATCFALCASDIEAEGLAERLETMRPDWWVRRCRLS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgtcagcgttcgccccggccaaggtcaatctgttcctgcatgtcggcgggccg
gacggggagggctatcatccgatctccagcctgatggtgttcgccgatgtcggcgaccgg
gtgaacctccagcccgccgacgcgccggcgttcgagacgtccgggccgttcggggatcag
attcccgccggcggcgacaatctggtggtccgcgcaggccaggctttccacaggcggctc
ggcggtccggttccgccttatcggctgatcctggagaagcacttgccgatcgctgcgggc
ctgggcgggggctccagcgacgcgggtgcggcgctcaagctgttgcgtgacgccctggcc
ccggcgctttccgatgacgatctggaggcgctggctgcgagccttggcgcggacggcgcg
gcctgtctgcgcgcgcgcgcccttatcgcagaagggcgaggcgagcggctgtcgccggcg
ccgcggttgcccgagttgaacgcagtgctggtcaatcccggcgcgccgtcgccgaccggc
gcggtctatcgcgcctatgacgcgggcgtgcacccagacggcgccgccatgccccccatg
cccgaccatctggagagcgctgaggaggccgccgcctggttggcctttgcgacacgcaac
gacctggaggcgccggccgtgaggcttgagccgcacatcggcgaggtgctggacgtgctg
cggggcgagccggaaagtctgctggtccgcatgtcgggttcgggtgcgacctgtttcgcg
ctctgcgccagcgatatcgaggccgaaggtctggccgagcgcctggagacgatgcgtccg
gactggtgggtgcggcgctgccgcctgagctga

DBGET integrated database retrieval system