KEGG   Caulobacter vibrioides NA1000: CCNA_01496
Entry
CCNA_01496        CDS       T00841                                 

Definition
(RefSeq) 2-dehydro-3-deoxyphosphooctonate aldolase
  KO
K01627  2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs00540  Lipopolysaccharide biosynthesis
ccs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CCNA_01496
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ccs01005]
    CCNA_01496
Enzymes [BR:ccs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     CCNA_01496
Lipopolysaccharide biosynthesis proteins [BR:ccs01005]
 Unusual sugar
  CCNA_01496
SSDB
Motif
Pfam: DAHP_synth_1
Other DBs
NCBI-GeneID: 7333170
NCBI-ProteinID: YP_002516869
UniProt: B8H5A9
Position
1606088..1606951
AA seq 287 aa
MDQPKAVAPNAVVEIKTPTGAPVRIGNGEKLSIIAGPCQMESRQHALETAHALKEMADRL
GVGLIYKTSYDKANRTSANAQRGIGLKDSLAIFQEIREVTGLPTLTDVHETSHCSIVAEA
VDVIQIPAFLCRQTDLLVAAASTGRAINIKKGQFLAPWDMKNVIAKVTGAGNPNVMACER
GASFGYNTLVSDMRALPIMKEIGCPVVFDATHSVQQPGGQGTSSGGQREFVPTLARAAVA
VGVACVFIETHPDPDNAPSDGPNMVPVKEFEALVANLLRYDALTKAA
NT seq 864 nt   +upstreamnt  +downstreamnt
gtggatcagcccaaagccgtcgcccccaacgccgtcgtcgagatcaagactccgaccggc
gcgcctgtccgcatcggcaacggtgagaagctgtcgatcatcgccggcccctgccagatg
gagagccgccagcacgccctggaaacggcgcacgcgctgaaggaaatggccgaccgcctg
ggcgtcggcctgatctacaagacctcctacgacaaggccaaccgcacctcggccaacgcc
cagcggggcatcggcctgaaagacagcctggcgatcttccaggaaatccgcgaggtcacc
ggcctgccgaccctgaccgacgtgcacgagaccagccactgctcgatcgtggccgaggcg
gtcgacgtcatccagattccggccttcctgtgccgccagaccgacctgctggtcgccgcc
gcgagcaccggccgcgcgatcaacatcaagaagggccagttcctggcgccgtgggacatg
aagaacgtgatcgccaaggtcacgggcgcgggcaacccgaacgtgatggcctgcgagcgc
ggcgcctcgttcggctacaacaccctggtcagcgacatgcgcgccctgccgatcatgaag
gagatcggctgcccggtcgtgttcgatgcgacccacagcgtccagcagccgggcgggcag
ggcacgtcctcgggcggccagcgcgagttcgtgccgaccctggcgcgggccgccgtcgcg
gtcggcgtggcctgcgtcttcatcgagacccaccccgatcccgacaacgcgccgtccgac
ggtcccaacatggtgccggtgaaagagttcgaggctctggtcgccaacctgctgcgctac
gacgccctgaccaaggccgcctga

DBGET integrated database retrieval system