KEGG   Caulobacter vibrioides NA1000: CCNA_01525Help
Entry
CCNA_01525        CDS       T00841                                 

Gene name
flbT
Definition
(RefSeq) flagellar biosynthesis repressor flbT
  KO
K06601  flagellar protein FlbT
Organism
ccs  Caulobacter vibrioides NA1000
Brite
KEGG Orthology (KO) [BR:ccs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:ccs02035]
    CCNA_01525 (flbT)
Bacterial motility proteins [BR:ccs02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    CCNA_01525 (flbT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlbT Abi_HHR
Motif
Other DBs
NCBI-GeneID: 7333199
NCBI-ProteinID: YP_002516898
UniProt: B8H5S2
Position
1634266..1634691
Genome map
AA seq 141 aa AA seqDB search
MPLKLSLKPGEKFVLNGAVVQNGDRRGVLVLQNKASVLREKDIMQPDQVTTPARHIYFPV
MMMYLDEVGAEKFYEEFATRLNEFMGVVRNPVVLQDCIAISKHVMAREYYKALMLSRKLI
EYEDERLGHVSSGVSAGGDAG
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
gtgcctttgaagctgtcgctgaagcctggggaaaagttcgttcttaacggcgctgtcgtg
cagaacggggatcgacgcggtgttctggttctccagaacaaggcgtccgtccttcgggag
aaggacatcatgcaaccggatcaggtgacgacgcctgcgcgtcacatctattttccggtg
atgatgatgtatctcgacgaggtcggggcggagaaattttacgaggaattcgctacgcgc
cttaacgaattcatgggcgttgtgcgcaatcctgtggtcctccaggactgcatcgccatc
tccaagcacgtgatggcgcgagaatactacaaggctctgatgttgagccggaagcttatc
gagtacgaagacgagaggttggggcatgtctcttcgggcgtatcagcaggcggcgacgcg
ggctga

DBGET integrated database retrieval system