KEGG   Caulobacter vibrioides NA1000: CCNA_01684Help
Entry
CCNA_01684        CDS       T00841                                 

Definition
(RefSeq) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs00360  Phenylalanine metabolism
ccs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccs00790  Folate biosynthesis
ccs01100  Metabolic pathways
ccs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CCNA_01684
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCNA_01684
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CCNA_01684
Enzymes [BR:ccs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     CCNA_01684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-GeneID: 7331744
NCBI-ProteinID: YP_002517057
UniProt: A0A0H3C764
Position
complement(1811466..1812350)
Genome map
AA seq 294 aa AA seqDB search
MSGDGLSNGPPPGARPDWTIDQGWETYTQAEHDVWITLYERQTDMLHGRACDEFMRGLDA
LDLHRSGIPDFARINEELKRLTGWTVVAVPGLVPDDVFFDHLANRRFPAGQFIRKPHELD
YLQEPDIFHDVFGHVPMLTDPVFADYMQAYGEGGRRALGLGRLANLARLYWYTVEFGLMN
TPAGLRIYGAGIVSSRTESIFALDDPSPNRIGFDLERVMRTLYRIDDFQQVYFVIDSIQT
LQEVTLRDFGAIYERLASVSDIGVAEIVPGDAVLTRGTQAYATAGGRLAGAAAG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagcggagatggcctgagcaacggaccgccccccggcgcgcgtcccgactggacgatc
gatcagggctgggaaacctacacccaggccgagcatgacgtctggatcaccctgtacgag
cggcagaccgacatgctgcacggccgtgcgtgcgatgagttcatgcggggactggacgcg
ctggacctgcaccgctcgggcattccggacttcgcccgcatcaatgaagagctcaagcgc
ctgacgggctggaccgtggtggccgtgccgggcctcgtgcccgacgacgtcttcttcgat
cacctcgccaatcgccgctttcccgccggccagttcatccgcaagccgcatgagctggac
tacctgcaggaacccgacatcttccacgatgtgttcggccatgtgccgatgctgaccgac
ccggtcttcgccgactacatgcaggcctatggcgaaggcggccgccgcgccctgggcctg
ggtcgcctggccaatctcgcgcggctctactggtacacggtggagttcggcctgatgaac
acccccgcaggccttcggatctatggcgcgggcatcgtgtcttcgcgcaccgagtcgatc
ttcgcccttgatgatccctcccccaaccggatcggtttcgatctggagcgcgtgatgcgc
acgctctaccggatcgacgacttccagcaggtctatttcgtgatcgactcgatccagacc
ctgcaggaggtgacccttcgcgacttcggcgcgatctacgagcggctggccagcgtcagc
gacatcggcgtcgccgagatcgttcccggcgacgccgtactgacacgcggcacccaggcc
tacgccacggccggcggtcggttggccggcgcggcggcgggctga

DBGET integrated database retrieval system