KEGG   Caulobacter vibrioides NA1000: CCNA_01827Help
Entry
CCNA_01827        CDS       T00841                                 

Gene name
cobQ
Definition
(RefSeq) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs00860  Porphyrin and chlorophyll metabolism
ccs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CCNA_01827 (cobQ)
Enzymes [BR:ccs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     CCNA_01827 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-GeneID: 7331294
NCBI-ProteinID: YP_002517200
UniProt: A0A0H3C8A6
Position
1953316..1954770
Genome map
AA seq 484 aa AA seqDB search
MAALMIQGCGSDVGKSVLVAGLCRVFANRGFAVRPFKPQNMSNNAAVTADGGEIGRAQAL
QAIACRTAPTVDMNPVLLKPQSDIGAQVVVRGRMAGSWAARGYQDHKASLLPTVVESFRT
LERQSDLVIVEGAGSPAEINLRVGDIANMGFARAADVPVVLVGDIDRGHVIAALVGAHAV
LDPEDRAMIKGFLINKFRGDPALFDDGRRAIVERTGWADLGMAPWLAAARRLPAEDAVVL
DARSAGRGGKVRIVVPMLSRIANFDEFDALRAEPGVEFAFVPPGSALPGDADLVILPGTK
ATRADLDFVRAQGWDIDLRAHLRRGGRVLGICGGYQMLGRRVADPDGVEGAPGTSEGLGL
LDVETVMTGDKTLRPVTGRLDGCARFEGYEMHVGRTSGAARPMLIFDTGEPDGAVSADGR
ISGCYVHGLFDRGEARAALLAALGAVSDAVNQAARVDLALDEIAAVLEQSFDIPALAKLA
GLSL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggccgccttgatgatccagggctgcggctcggatgtcggaaagtcggtgctggtcgcc
ggcctgtgccgggtgttcgccaatcgcggcttcgcggtgcggcccttcaagcctcagaac
atgtcgaacaacgccgccgtcaccgcagacggcggcgagatcggccgcgcccaggccctg
caggcgatcgcctgtcggacggcgccgacggtcgacatgaaccccgtgctgctcaagccg
cagagcgatatcggcgcgcaggtggtggtgcgcgggcggatggcggggtcctgggcggcg
cgcggctatcaggaccacaaggctagcctgctgccgaccgtggtggagagctttcgcacg
ctggaacgccagagcgatctggtcatcgtcgagggggccggcagcccggctgagatcaac
cttcgggtcggcgacatcgccaatatgggcttcgcccgcgccgccgacgtgccggtcgtc
ctggtcggcgatatcgaccggggccatgtgatcgccgcgctcgtcggggcgcacgccgtg
ctcgatccggaggatcgggcgatgatcaagggcttcctgatcaacaagtttcgcggcgat
ccggccctgttcgacgacggtcggcgggcgatcgtggagcgcaccggctgggccgacctt
ggcatggcgccgtggctggcggcggcgcgccggctcccggccgaggacgcggttgtgctg
gacgcgcgttcggccgggcgtggcggcaaggtccgcatcgtcgttccaatgctctcccgc
atcgccaatttcgacgagttcgacgcgctgcgcgctgagcctggggtcgagttcgccttc
gtgccgccaggctcggcgctgccgggcgacgccgacctggtgatcctgcccggcacgaag
gccacgcgggcggatctcgactttgttcgcgcccagggctgggacatcgacctgcgtgcc
catctgcggcgcggcggccgcgtgctggggatctgcggcggctatcagatgctgggccgg
cgcgtggccgatcccgacggcgtcgagggcgcgccggggacttcggaaggccttggcctg
ctcgacgtcgaaaccgtgatgaccggcgacaagaccttgcggccggtcacgggccgcctg
gacggctgcgcgcgcttcgaggggtatgagatgcatgtcggccgcacgtctggcgcggcg
cgaccgatgttgatctttgacacgggtgagccggacggcgccgtttcggcggacgggcgg
atcagcggctgctacgtccacggcctgttcgatcgcggtgaggcccgcgcggcgcttctg
gcggcgctgggcgcggtctcggacgccgtcaatcaggccgcgcgcgtggatctggccctc
gacgagatcgcggcggtcctggagcaatcgttcgacattccggccctggccaaactggcc
ggactgtcgctctag

DBGET integrated database retrieval system