KEGG   Caulobacter vibrioides NA1000: CCNA_01976Help
Entry
CCNA_01976        CDS       T00841                                 

Definition
(RefSeq) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccs01100  Metabolic pathways
ccs01110  Biosynthesis of secondary metabolites
ccs01130  Biosynthesis of antibiotics
ccs01230  Biosynthesis of amino acids
Module
ccs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCNA_01976
Enzymes [BR:ccs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CCNA_01976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS CP_ATPgrasp_2 FMN_dh Lactamase_B_5
Motif
Other DBs
NCBI-GeneID: 7330116
NCBI-ProteinID: YP_002517349
UniProt: B8GWP9
Position
2120897..2121685
Genome map
AA seq 262 aa AA seqDB search
MTDILAKIAAYKREDVAARKAERSQAEIDAAAKAASAPRGFKAALEAHHAPGRLSLIAEI
KKASPSKGLIREDFDPPVLAKAYEAGGAACLSVLTDGPSFQGADDYLVTARAAVALPCIR
KDFLVDPWQVAESRALGADAILVILAMIDDVLAAELMSEARRLGMDALVEVHDEAEMARA
GALGSDLVGINNRDLKSFVVDLAVTERLSAQAPRDALLVTESGIFTHDDVVRMEATGAKA
MLVGESLMRHADVTSATRALIA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacatcctggccaagatcgccgcctacaagcgtgaggacgtggcggcgcgaaaa
gccgagcggtctcaagccgagatcgacgccgccgccaaggccgcttcggcgccgcgcggc
ttcaaggccgcccttgaggcgcatcacgcgcccggccgtctctccctgatcgccgagatc
aagaaggcctcgccgtccaagggcctgatccgcgaggacttcgatccgccggtcctagcg
aaagcctatgaagccggcggcgcggcctgcctctccgtgctgaccgatggaccgagtttt
cagggcgcggatgactacctcgtcaccgcccgggcggcggtcgccctgccctgcatccgc
aaggatttcctggtcgatccctggcaagtggccgaaagccgcgccctgggcgccgacgcg
atcctggtgatcctggcgatgatcgacgacgtcctggcggcggagctgatgtccgaagcg
cgtcggctgggcatggacgcccttgtcgaggtgcacgatgaggccgaaatggcgcgcgcc
ggcgctttgggctcggatctggtcggcatcaacaaccgtgatctcaagagctttgtcgtc
gatctggcggtgaccgagcgcctgtcggcccaggccccgcgcgacgccctgctggtcacc
gaaagcggcatcttcacccatgacgatgtcgtccgcatggaagccaccggggccaaggcc
atgctggtcggcgaaagccttatgcggcacgcggacgtgacgagcgccacgcgcgccctg
atcgcttaa

DBGET integrated database retrieval system