KEGG   Caulobacter vibrioides NA1000: CCNA_02198Help
Entry
CCNA_02198        CDS       T00841                                 

Definition
(RefSeq) trans-isoprenyl diphosphate synthase
  KO
K02523  octaprenyl-diphosphate synthase [EC:2.5.1.90]
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs00900  Terpenoid backbone biosynthesis
ccs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCNA_02198
Enzymes [BR:ccs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.90  all-trans-octaprenyl-diphosphate synthase
     CCNA_02198
Prenyltransferases [BR:ccs01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CCNA_02198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 7333449
NCBI-ProteinID: YP_002517571
UniProt: A0A0H3C986
Structure
PDB: 

Position
complement(2347464..2348474)
Genome map
AA seq 336 aa AA seqDB search
MDAAAATLPRKSGSVDRLVRLAEADMAGVNRLITDRMQSDVAIIPALAEHLIAAGGKRLR
PLMTVAAARLAGADNDHFQKLAAAVEFIHTATLLHDDVVDGSQLRRGKVAAHLIWGGAQS
VLVGDFLFARAFELMVETNSMKALEILARASRVIAEGEVLQLMRSHDLNLSQAVYLEIIQ
AKTAELFAAASEAGAVSAGVDVAKSEALRDYGLNLGLAFQLADDALDYGGATETLGKNAG
DDFREGKATLPLLLAIARSGPREAEFWERAIGRREQTEADFRRARELIIGSGALDATLDL
AADYADKAKAALAMFPANDWREALEELADFAVSRRA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
ttggacgcagccgcagcgaccctgccccggaagtcgggatcggtggatcgtctcgtgcgc
ctcgccgaggccgacatggcgggcgtcaaccgtctgatcaccgatcgcatgcagagcgat
gtggcgatcatccccgccctggccgagcatctgatcgccgcgggcggcaagcgcctgcgt
ccgctgatgaccgtggccgccgcgcgtctggccggcgccgacaacgaccacttccagaag
ctggccgccgccgtcgaattcattcacaccgccaccctgctgcatgacgatgtcgtcgac
ggcagccagctgcgccgcggcaaggtcgccgcgcacctgatctggggcggcgcgcagagc
gtgctggtcggcgacttcctgttcgcccgcgccttcgagctgatggtcgagaccaactcc
atgaaggcgctggagatcctcgcccgcgccagccgcgtcatcgccgagggcgaggtgctg
caactgatgcgcagccacgacctgaatctgtcgcaggcggtctatctggagatcatccag
gccaagaccgccgagctgttcgccgccgcttcggaagccggggcggtttcggccggtgtc
gatgtggcgaagtccgaggctttgcgggattacggcctgaacctgggtctggcgttccag
ctggccgacgacgccctggattacggcggcgcgaccgaaaccctgggtaagaacgccggc
gacgacttccgcgaaggcaaggccacactgccgctgctgctggccatcgcccgctcgggt
ccccgcgaagccgagttctgggagcgcgctatcggtcggcgtgagcagactgaggccgat
ttccgtcgcgcccgcgaactgatcatcggctcgggcgcgctggacgcgacgctggatctg
gccgctgactatgccgacaaggccaaggccgcgctggcgatgttcccggccaatgactgg
cgcgaggcgcttgaggagctggccgactttgcggtcagccgccgcgcctag

DBGET integrated database retrieval system