KEGG   Caulobacter vibrioides NA1000: CCNA_02431Help
Entry
CCNA_02431        CDS       T00841                                 

Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs00340  Histidine metabolism
ccs01100  Metabolic pathways
ccs01110  Biosynthesis of secondary metabolites
ccs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    CCNA_02431
Enzymes [BR:ccs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CCNA_02431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh PNP_phzG_C
Motif
Other DBs
NCBI-GeneID: 7331665
NCBI-ProteinID: YP_002517804
UniProt: A0A0H3C921
Position
complement(2571951..2573237)
Genome map
AA seq 428 aa AA seqDB search
MRRFLFSDPDFQTAFKAFLDERRGSPADVDAAVAGVLEAVRTQGIEALLDYSRRFDKVDL
TAETIRVTAEEIEAGAAETPADVREAIAFAAARIRAYHSRQRPADQAWTDEAGVELGWRW
TPLEAVGVYVPGGRAAYPSTVLMNAVPAQVAGVDRIAMVTPPGKLQPAVLAAAKEAGVTE
IWRVGGAQAVAALAYGAGPIQPVDKIVGPGNAYVTAAKRRLYGVVGIDALAGPSEIVVVA
DNKNNPDWIAADLLSQAEHDPAAQSILITDDEAFAAAVEQAIAERLKTLATGEDAAASWR
DHGAVIIAPLDESPALVDAIAPEHVEFALDNPERLSDRVRHAGAIFLGRVTPEAIGDYVA
GSNHVLPTSRAARFQSGLSIYDFIKRTSIVKCDPASFAVLGPHTVALAKAEGLPAHALSA
SVRLPSGD
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcttcctgttttccgaccccgatttccagaccgccttcaaggccttccttgac
gagcgtcgcggctcgccggctgatgtcgacgccgccgtcgctggcgtgctcgaggccgtc
cgtacgcaggggatcgaggcgctgctcgactacagccgccgcttcgacaaggtcgacctg
acggccgagaccatccgcgtgaccgccgaggagatcgaggccggcgcggccgagacgccg
gcggacgtccgcgaggccatcgccttcgccgccgctcgcattcgcgcctatcacagccgc
cagcgtccggccgaccaggcctggaccgacgaggccggcgtcgagctgggatggcgctgg
acgccgctggaggccgtgggggtttatgtgcctggcggtcgcgcggcctatccctcgacc
gtgctgatgaacgccgtcccggcccaggtcgccggtgtcgaccgcatcgccatggtcacc
ccgcccggcaagctgcagccggccgtgctggccgccgccaaggaagccggcgtcaccgag
atctggcgcgtaggcggggcccaggccgtcgccgccctggcctatggcgcgggacccatc
cagccggtcgacaagatcgtcggtcccggcaacgcctatgtcaccgccgccaagcgccgc
ctttacggcgtggtgggcatcgacgccctggctggcccctcggagatcgtcgtggtcgcc
gacaacaagaacaatcccgactggatcgccgccgacctgctcagccaagccgaacacgac
ccggccgcccagtcgattctgatcaccgacgacgaggccttcgctgcggcggtcgaacag
gccatcgccgagcgcctcaagaccctggccacaggcgaggacgccgcggcctcgtggcgc
gaccacggcgcggtgatcatcgcgccgttggacgagagcccggccctggtcgacgccatc
gcgcccgagcacgtcgagttcgcgctcgacaatcccgagcgcctgtccgaccgggtgcgg
cacgccggcgcgatcttcctgggccgtgtcacgcccgaagccatcggcgactatgtcgcg
ggctccaaccacgtgctgccgaccagccgcgcggcgcggttccagtcgggcctgtcgatc
tacgacttcatcaagcgcacctcgatcgtgaagtgcgatccagcctcgttcgccgtgctc
ggaccgcacacggtggccttggccaaggctgaagggctgccggcgcacgccttgtctgcg
tcagtgaggttgccaagcggcgactga

DBGET integrated database retrieval system