KEGG   Caulobacter vibrioides NA1000: CCNA_02518Help
Entry
CCNA_02518        CDS       T00841                                 

Definition
(RefSeq) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs00970  Aminoacyl-tRNA biosynthesis
ccs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CCNA_02518
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ccs03029]
    CCNA_02518
Enzymes [BR:ccs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CCNA_02518
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CCNA_02518
Mitochondrial biogenesis [BR:ccs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CCNA_02518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey HTH_7
Motif
Other DBs
NCBI-GeneID: 7330671
NCBI-ProteinID: YP_002517891
UniProt: A0A0H3CCC0
Position
complement(2667679..2669175)
Genome map
AA seq 498 aa AA seqDB search
MNENTKVIKGRTGDWEMVLGLEVHAQVASKSKLFSGAAVGFGAGPNEQVSLVDAAMPGML
PVLNRFCVEQAVKTGLGLRAQINLKSRFDRKNYFYPDLPQGYQISQFDQPIVGEGVVSVE
RDDGTTFDVRIERLHLEQDAGKSLHDQDPNATYVDLNRAGTALMEIVSKPDMRTSEEAAA
YVKKLRTILVYLGTCDGDMEKGNLRADVNVSVCRPGDYEKFRATGDFKHLGTRCEIKNVN
SYRYIQQAIEYEARRQIEILEDGGKVDQETRLFDPTKGETRSMRSKEEAHDYRYFPDPDL
LPLVLDPAWVKSIEETLPELPDAKKARLQSQYGLSAYDAGVLIIDADRADYFEAAAKGRD
AKLVANWVTNELLAKLSAAGTEFTNSPLPHTDIAQLVELIENGTISSKIAKEVFEHMWAG
EGRPAEIVEKRGLVQINDTGAIEKAIDDLIAGNPDKAEAVKDKPQALGWFVGQVMKATGG
KANPGTVNELLRKKLGVE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaacaccaaggtcatcaagggccgcacgggcgactgggaaatggtcctcggt
cttgaggtccacgcccaggtcgccagcaagtccaagctcttctcgggcgccgccgtcggt
ttcggcgcggggccgaacgagcaggtcagcctcgtggacgcggccatgcccggcatgctg
ccggtgctgaaccggttctgcgtcgagcaggcggtgaagacgggcctgggtctgcgcgcg
cagatcaacctgaagagccgctttgaccggaagaactacttctatccggatctgccgcag
ggctatcagatcagccagttcgaccagccgatcgtcggcgagggcgtggtcagcgtcgaa
cgcgacgacggcacgaccttcgacgtgcgcatcgagcgcctgcacctggaacaggacgcc
ggcaagtcgctgcacgatcaggatccgaacgcgacctatgtcgacctgaaccgcgccggc
accgcgctgatggagatcgtctccaagcccgacatgcgcacctccgaagaggccgccgcc
tatgtgaagaagctgcgcacgatcctggtctatctgggcacctgcgacggcgacatggag
aagggcaacctgcgcgccgacgtcaacgtctcggtctgccgtcccggcgactatgagaag
ttccgcgccacgggcgacttcaagcacctgggcacgcgctgcgagatcaagaacgtcaac
tcgtatcgctacatccagcaggccatcgaatatgaggcccgtcgccagatcgagatcctc
gaggacggcggcaaggtcgatcaggaaacccgcctgttcgacccgaccaagggcgagacg
cgctcgatgcgttcgaaggaagaggcgcacgactatcgctacttccccgatccggacctg
ctgccgctggtgctggacccggcctgggtgaagtcgatcgaagagaccctgccggagctg
ccggacgccaagaaggcgcgcctgcagagccagtatggcctctcggcctatgacgcgggc
gtcttgatcatcgacgccgaccgcgccgactacttcgaggcggccgccaaggggcgcgac
gccaagctggtggccaactgggtcaccaacgaactgctagccaagctgtcggccgccggg
accgagttcacgaactcgccgctgccgcacaccgacatcgcccagctggtcgagctgatc
gagaacggcaccatctcctcgaagatcgctaaggaggtcttcgagcacatgtgggctggc
gaaggccgtcccgccgagatcgtcgagaagcgcggcctggtgcagatcaacgacaccggc
gccatcgagaaggccatcgacgacctgatcgcgggcaatcccgacaaggccgaagccgtg
aaggacaagccgcaggctctgggctggttcgtcggtcaggtcatgaaggccaccggcggc
aaggccaatccgggcacggtcaacgagcttctgcgcaagaagctgggcgtcgagtag

DBGET integrated database retrieval system