KEGG   Caulobacter vibrioides NA1000: CCNA_03026Help
Entry
CCNA_03026        CDS       T00841                                 

Definition
(RefSeq) two-component response regulator petR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ccs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CCNA_03026
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ccs02022]
    CCNA_03026
Two-component system [BR:ccs02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   CCNA_03026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-GeneID: 7333480
NCBI-ProteinID: YP_002518399
UniProt: A0A0H3CC56
Position
3180781..3181482
Genome map
AA seq 233 aa AA seqDB search
MTPDERRERHLLVVDDDDRLRKLIKEFLSRAGFRVTAASSAAAADKLFDALDFDLMVLDV
MMPGEDGMAFTKRLRAKGGEAGRTPILMLTARDQTADRIEGLSSGVDDYLGKPFEPQELL
LRIEAILRRSAARPVGPKALSLGRCTFDADRGELTCDGEAVRITEAEVTLLRRLARSLHE
PVDRLELARDTADATGRAVDVQVTRLRRKIEPDPKNPRYLQTVRGVGYRLAPD
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgacccctgacgagcgccgcgaacgccatctgctggtggtcgacgacgacgaccggctg
cgcaagctgatcaaggaattcctgagccgcgcgggctttcgcgtcaccgccgcctcaagc
gccgcggcggccgacaagctgttcgatgccctggacttcgacctgatggtgctggacgtg
atgatgccgggcgaggacggcatggccttcaccaagcgcctgcgcgccaagggcggcgag
gccggccgcacgccgatcctgatgctgaccgcccgcgaccagaccgccgatcggatcgag
ggcctgtccagcggcgtcgacgactatctgggcaagccgttcgagccgcaggaactgctt
ctgcgcatcgaggccatcctgcgccgctcggccgcgcgccccgtcggccccaaggcgctg
agccttggccgttgcaccttcgacgccgaccggggcgagctgacctgcgacggcgaggcc
gtgcggatcaccgaggctgaagtgaccctgctgcggcgcctggcccgctcgctgcacgag
ccggtcgaccgcctggaactggcccgcgacaccgccgacgccaccggccgcgccgtcgac
gttcaggtcacccgcctgcgccgcaagatcgagccggacccgaagaacccgcgctacctg
cagacggtgcggggtgtggggtatcggctggcgccggattga

DBGET integrated database retrieval system