KEGG   Caulobacter vibrioides NA1000: CCNA_03305
Entry
CCNA_03305        CDS       T00841                                 

Definition
(RefSeq) SSU ribosomal protein S7P
  KO
K02992  small subunit ribosomal protein S7
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ccs00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CCNA_03305
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ccs03011]
    CCNA_03305
Ribosome [BR:ccs03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    CCNA_03305
  Bacteria
    CCNA_03305
  Archaea
    CCNA_03305
SSDB
Motif
Pfam: Ribosomal_S7
Other DBs
NCBI-GeneID: 7330327
NCBI-ProteinID: YP_002518677
UniProt: B8H415
Position
complement(3483183..3483656)
AA seq 157 aa
MSRRRRAEKRQVLPDPKFGDLVVTKFMNYVMYEGKKAVAENIIYGAFDILEAKRKDQGPL
ETFHSALDNVAPAIEVRSRRVGGATYQVPVEVRPDRRRALAIRWLVTAARKRGENTMTEK
LAGELLDASNNRGTAVKKREDTHKMAEANRAFSHYRW
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtcccgccgccgtcgcgccgagaaacgccaagtcctgccggatcccaagtttggggat
ctggttgtcacgaagttcatgaactacgtgatgtacgagggcaaaaaagccgtcgccgaa
aacatcatctatggtgctttcgacatcctggaagccaagcgcaaggaccaaggtccgctt
gaaaccttccactccgctctggacaacgtcgctccggcgatcgaagtccggtcgcgtcgc
gttggcggcgccacctaccaagtgccggttgaagtccgtccggaccgtcgccgcgccctg
gccatccgttggctggtgaccgccgctcgcaagcgcggtgagaacaccatgaccgaaaag
ctggccggcgagctgctcgacgcctcgaacaaccgcggcaccgccgtgaagaagcgcgaa
gacacccacaagatggctgaagccaaccgggcgttctcgcactaccgctggtaa

DBGET integrated database retrieval system