KEGG   Coprococcus catus: CC1_12900Help
Entry
CC1_12900         CDS       T02584                                 

Definition
(GenBank) helicase, putative, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cct  Coprococcus catus
Pathway
cct03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cct00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CC1_12900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cct03400]
    CC1_12900
Enzymes [BR:cct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CC1_12900
DNA repair and recombination proteins [BR:cct03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CC1_12900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 SH3_13 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 PIF1 Helicase_RecD AAA_22 AAA HHH_2 NTPase_1 T2SSE AAA_28 UvrD-helicase UvrD_C PhoH DUF2075 AAA_23 AAA_16 MeaB Thymidylate_kin AAA_29 AAA_14 SRP54 6PF2K AAA_24 Mg_chelatase cobW AAA_18 ABC_tran
Motif
Other DBs
NCBI-ProteinID: CBK80090
UniProt: D4J6W9
Position
1333237..1335459
Genome map
AA seq 740 aa AA seqDB search
MESIQGLVEHIVYHNDTNGYTVFSLMCQGEEIVCVGNVTSLDEGEYLKAEGEYTEHQVYG
RQFKVTSMSVEVPEDEYSIERYLGSGAIRGVGPSLAARIVKKFKKDSFRIIEEEPERLAE
IKGISERKAREIYQQFHEKQDMRQAMMFLAKYGITTTLSLRIYKQYGEEMYRIIQENPYR
LADDMNGIGFKLADEIAKKAGIGSHSDFRIRSGIIYMLQQGTLSGHIYIPAALLVEKTAQ
MLGVEEEAVDHLLQSLQMDRKIVVKKIDDVSVVYGASLYRLELETAGLLKNLGVDYSVDE
KEVGKVLDRIEKREGIDLDDHQREAVYSAAGNGVLVITGGPGTGKTTTINAIIKYLEYEG
LEMRLAAPTGRAAKRMSEATGREAQTIHRMLELSGGPDDDRLRTQFERNQDNPLETDVVI
IDEMSMVDIYLMNALLKAIAVGTRLILVGDVNQLPSVGPGNVLKDIIDSECFQVVRLTKI
FRQALESDIIKNAHLINEGRQIELGNKSQDFFCLKRYDVQQILGVMVLLIRDKLPKFVNA
KPYDIQVLTPMRKGELGVERLNTVLQHYLNPPSSDKKEREFHQGVIREGDKVMQIRNNYQ
IEWEVLGHYNLPLDKGVGVFNGDMGVVREINHFAEQLVVEFDEGRRVTYGFAQLDELELA
YAITIHKSQGSEYPAVIMPLLSGPRMLFNRNILYTAVTRAKQCVAIVGDEHTVRHMIENE
KQQKRYTSLNLRLREMNTLS
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcatacagggacttgtggagcatattgtctatcacaatgacaccaatggatat
acagttttttccctgatgtgccagggggaagagattgtctgtgtgggaaatgtcacttcg
ctggatgaaggagaatatctcaaggcagagggtgaatatacggaacatcaggtatatgga
agacagttcaaggtgacttccatgagtgtggaagtgccggaggatgaatattccattgaa
agatatctcggttccggggccatcaggggtgtgggaccgtcactggcagcccgcattgtc
aagaaattcaaaaaggattctttcaggatcattgaagaagaaccggagcggttggctgag
atcaagggcatcagtgaacgcaaagccagggagatctatcagcagtttcatgagaagcag
gatatgcgtcaggccatgatgtttctggcgaaatacgggattacaacaaccttatccctg
agaatttacaaacagtacggcgaggagatgtaccggatcattcaggagaatccgtaccgg
ctggccgatgatatgaacggcatcggtttcaaattggcggatgagatcgccaaaaaggcc
gggattggttcccattcagattttcgaatccgcagcggcattatctatatgctgcagcag
ggaaccctttccgggcatatttacataccggcggcattgctggtggagaagacggcccag
atgctgggggtggaagaagaagctgtggaccatctgcttcagagcctgcagatggaccgc
aagattgttgtgaagaaaatagacgatgtgtcggtggtgtatggagcctcactttaccgc
ctggagctggagaccgcgggacttctgaagaatcttggtgtcgattacagcgtggatgag
aaggaagtaggaaaggttctggaccgtattgagaaaagggaaggcattgatctggatgat
caccagcgtgaagcggtgtattctgctgcaggcaatggggtgcttgtcatcaccggcggt
cccggtaccggtaaaaccacgacgattaatgccattatcaaatacctggaatatgaaggg
ttggagatgcgtctggcggcgccgacgggaagagcggccaaacgtatgtcagaagccaca
ggacgggaggcccagaccattcaccggatgctggaattatcaggcggaccggatgacgac
cgcctgcgaacacagtttgagcgcaatcaggacaatcccctggaaacggatgtggtcatt
attgatgagatgtctatggtggatatctatctgatgaatgcccttttgaaggccatagcc
gtgggcacaaggctgatccttgtaggggatgtgaaccagctgccgagtgtcggaccgggc
aatgtgctgaaggatatcattgattctgaatgttttcaggtggtacgtctgacgaagatt
ttcagacaggcactggaaagcgatatcattaagaatgcccatctgatcaatgagggacgg
caaattgaacttggcaacaaaagccaggactttttctgcctgaaacgatatgatgtccag
cagattctgggggtcatggtgcttctgatcagagacaagcttccgaagtttgtcaatgca
aagccttacgatatccaggtgctgacgccgatgcgcaaaggagaactgggggtagagcgg
ctgaataccgtactgcagcactatctgaacccgccgtcttcggacaagaaagagcgcgaa
tttcatcagggtgttatccgtgaaggggacaaggttatgcagatcaggaataattatcag
atcgaatgggaagtgctgggacattataatctgcctttggacaagggcgtgggcgttttt
aacggcgatatgggcgttgtccgggagatcaatcattttgcggaacagctggtggtagaa
tttgatgaaggacgcagggtgacctatggttttgcacagcttgacgaactggaactggct
tatgccattacaatccacaaatctcagggcagtgagtatccggctgtcattatgccgctg
ctgtccggcccgcgcatgctgtttaacagaaatattctttatacagcagtgacccgtgcc
aagcagtgtgtggccattgtgggggatgagcataccgtccgtcatatgatcgagaatgaa
aaacaacaaaagagatatacgtctttgaatctgcgtctcagagaaatgaatacactttca
tag

DBGET integrated database retrieval system