KEGG   Coprococcus catus: CC1_13310Help
Entry
CC1_13310         CDS       T02584                                 

Definition
(GenBank) N-acetylglucosamine 6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
cct  Coprococcus catus
Pathway
cct00520  Amino sugar and nucleotide sugar metabolism
cct01100  Metabolic pathways
cct01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CC1_13310
Enzymes [BR:cct01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     CC1_13310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: CBK80127
UniProt: D4J706
Position
1381257..1382474
Genome map
AA seq 405 aa AA seqDB search
MIPCIYSSVKTDRGDNKMKTLIKNGQVYMNRHFEKKDLLLDDRKIAVIGDFLEPEDADTA
VYDAEGCYVTPGFIDVHTHGGFGVDVNAATQEDYEKIGHFFAKEGTTSWHCSILTDTEEQ
TDWCIKEAVKHYETNTAAGQPHGNCADLMGIHLEGPFLASEYKGAMPEYLLRTADMPLLK
HYQETAGGFIHYITVSPEVAGIPEHVKDITEMGIKVAIGHSGADYATSWKCIDAGAAAAT
HTFNAMRLFHQHEPAIMGAVLESDVYCEAICDGRHLHPGSVRFLLKMKGYDRVIAITDSI
MAAGLPDGNYKLGVNDVIVEEGDAKLKDGTRAGSTLTTGQAFRNLMKFTGESPEKILPLL
TENPATMLGLQNRIGFIGEGRDADVLIMDSEFQIKETFVKGRRII
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgattccctgcatttacagcagtgttaaaacagacagaggcgataacaaaatgaaaaca
ttaattaaaaatggacaggtttatatgaaccgccattttgagaagaaagatttattgttg
gatgacagaaagattgctgtgatcggagattttcttgagccggaagatgcggatacagca
gtatatgatgcggaaggctgttatgtcacaccgggatttatcgatgtgcatacacatggt
ggttttggtgtggatgtcaatgcagccacacaggaagattacgagaaaatcggccatttc
tttgcaaaggaaggcaccacatcctggcattgctctatcttgacggatactgaagagcag
acagactggtgcattaaagaagctgtgaagcattatgaaaccaatacagcagcaggacag
ccgcacggcaattgtgcggatctgatgggaatccatttggagggaccgttcctggcatcg
gagtacaaaggggcgatgcctgaatatctgcttcgtacagcggatatgccgcttttaaag
cactatcaggagacagcaggcggttttattcattacataactgtatcaccggaagttgca
ggtattccggagcatgtcaaagatatcactgagatgggcatcaaagtggctatcggtcat
tccggtgcggattatgccacatcctggaaatgtatcgatgccggtgcagcagccgcaacc
catacatttaatgcgatgcgcctgttccatcagcatgagccggccatcatgggtgcggtt
cttgaatcggatgtatactgcgaagctatttgcgatggccgacatcttcatccgggttct
gtccgtttccttttgaaaatgaaggggtatgacagagtcattgccatcacagactccatt
atggccgcaggactgccggacggcaactacaaactgggagtcaacgatgtcattgttgaa
gaaggtgatgcaaaactcaaagatggtacaagagccggcagtaccctgacaacgggacag
gcattcagaaatctgatgaaattcaccggcgaaagccctgagaagattcttccattgctg
acagagaacccggccaccatgttggggctgcagaacagaattggcttcatcggcgaaggc
agagatgccgatgtgctgattatggacagcgaattccagataaaagaaacatttgtcaaa
ggacgtcgaattatttag

DBGET integrated database retrieval system