KEGG   Coprococcus catus: CC1_14010Help
Entry
CC1_14010         CDS       T02584                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
cct  Coprococcus catus
Pathway
cct03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cct00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CC1_14010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cct03011]
    CC1_14010
Ribosome [BR:cct03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CC1_14010
  Bacteria
    CC1_14010
  Archaea
    CC1_14010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF2423
Motif
Other DBs
NCBI-ProteinID: CBK80186
UniProt: D4J765
Position
complement(1437989..1438375)
Genome map
AA seq 128 aa AA seqDB search
MAKGHRSQIKRERNSNKDTRPSAKLSFARIPVQKACFVLDAIRGKDVETALAILAYNPRY
ASTVIDKLLKSAIANAENNNGMDRSKLFIEECYASNGPIMKRVQPRAQGRAYRIEKRMSH
ITIVLNER
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaggacatagatcccagataaagagagaaagaaacagcaataaggatacaaga
ccaagcgcaaagctgtcttttgcaagaattcctgttcagaaagcttgtttcgttcttgac
gcaatcagaggcaaggatgtagaaacagcattagcaattttagcatacaacccaagatat
gcttcaacagttatcgataaattattaaaatcagcaattgcaaacgcagaaaacaacaac
ggtatggacagaagcaaactctttatcgaagagtgctacgcaagcaatggcccaatcatg
aagagagtacagcctagagcacagggcagagcttacagaatcgaaaagagaatgagccat
atcacaatcgtgctgaatgaaagataa

DBGET integrated database retrieval system