KEGG   Coprococcus catus: CC1_15940Help
Entry
CC1_15940         CDS       T02584                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cct  Coprococcus catus
Pathway
cct00071  Fatty acid degradation
cct00280  Valine, leucine and isoleucine degradation
cct00310  Lysine degradation
cct00362  Benzoate degradation
cct00380  Tryptophan metabolism
cct00620  Pyruvate metabolism
cct00630  Glyoxylate and dicarboxylate metabolism
cct00640  Propanoate metabolism
cct00650  Butanoate metabolism
cct00900  Terpenoid backbone biosynthesis
cct01100  Metabolic pathways
cct01110  Biosynthesis of secondary metabolites
cct01120  Microbial metabolism in diverse environments
cct01130  Biosynthesis of antibiotics
cct01200  Carbon metabolism
cct01212  Fatty acid metabolism
cct02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CC1_15940
   00630 Glyoxylate and dicarboxylate metabolism
    CC1_15940
   00640 Propanoate metabolism
    CC1_15940
   00650 Butanoate metabolism
    CC1_15940
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CC1_15940
   00072 Synthesis and degradation of ketone bodies
    CC1_15940
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CC1_15940
   00310 Lysine degradation
    CC1_15940
   00380 Tryptophan metabolism
    CC1_15940
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CC1_15940
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CC1_15940
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CC1_15940
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cct04147]
    CC1_15940
Enzymes [BR:cct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CC1_15940
Exosome [BR:cct04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CC1_15940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Asp_protease_2
Motif
Other DBs
NCBI-ProteinID: CBK80359
UniProt: D4J7N8
Position
1645130..1646314
Genome map
AA seq 394 aa AA seqDB search
MKKAVIVSACRTAIGAFGGTLKDVPAAELGALVVKEAVSRAGIKPEQVDEVIFGNVLQAG
LGQNVARQVTLKAGLPIETTAVTINIVCGSGLKSVAMAANQILAGESEIVVCGGTENMSA
APYAIPTARWGARMNNNKMIDVMVNDGLWDAFNQYHMGITAENVAEKYGITREMQDEFAV
ASQSKAEAAVKGGKFKEEIVPVVIHGKKGDTVFDTDEYPKFGTTLEKVAKLKPAFKKDGG
TVTAANASGINDSAAAFVVMSQEKAEELGLKPMATIVSYATGGVDPSIMGVGPVPAVKKA
MAKADLTIDDIDLIEANEAFAAQSLAVAQELKFDMNKVNVNGGAIALGHPIGASGARILV
TLLYEMQKREDAKKGLATLCIGGGQGQALIVEKA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcagttattgtcagcgcatgcagaacagcgatcggtgcatttgggggtact
ttaaaggatgttcctgcagcagagcttggcgcacttgttgtaaaagaagccgtttcaaga
gcgggcattaagccggaacaggtggatgaagttatttttggtaatgtattgcaggccggt
ctcggacaaaatgttgcccgtcaggtaactttaaaggcgggacttccaatcgagacaaca
gctgtgacaatcaatatcgtgtgtggttccggtctgaagagtgtggccatggcagccaac
cagatccttgcaggcgaatctgaaatcgttgtctgcggcggtacagaaaatatgagtgca
gcgccatatgccattccaacggcacgttggggtgcaagaatgaacaataacaagatgatt
gatgttatggtcaatgatggactgtgggatgctttcaatcagtatcatatgggtatcaca
gctgaaaacgttgcagagaaatatggtatcacaagagaaatgcaggatgaatttgcagtg
gcttcccagagcaaagcagaagcagctgttaagggtggcaagttcaaagaggaaattgtt
cctgttgtgattcacggcaagaaaggtgatacagtctttgatacagatgaatatcctaaa
ttcggcacaacacttgaaaaagttgccaaattaaaaccggccttcaagaaagatggcggt
acagttacagcagcgaatgcttccggtatcaatgacagcgctgcagcatttgttgtgatg
agccaggaaaaagcagaagaacttggcctgaaaccaatggcaactatcgtttcctatgca
acaggcggtgtcgatccatctatcatgggtgttggtccggtgcctgctgttaagaaagct
atggcaaaagcagatcttaccatcgatgatattgatctgatcgaagcaaatgaagcattt
gcagcccagtctctggcagttgctcaggaactgaaatttgatatgaacaaagtgaatgtc
aatggtggtgccatcgccctcggacatccgatcggtgcatccggtgccagaatccttgtg
acattattatacgaaatgcagaagagagaggacgcaaagaaaggccttgccacattgtgt
attggcggcggacagggtcaggcgctcatcgttgaaaaagcttaa

DBGET integrated database retrieval system