KEGG   Coprococcus catus: CC1_24550
Entry
CC1_24550         CDS       T02584                                 

Definition
(GenBank) xanthine dehydrogenase, molybdenum binding subunit apoprotein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cct  Coprococcus catus
Pathway
cct00230  Purine metabolism
cct01100  Metabolic pathways
cct01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cct00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CC1_24550
Enzymes [BR:cct01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CC1_24550
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: CBK81109
UniProt: D4J9T8
Position
complement(2478395..2480683)
AA seq 762 aa
MGIGKSIQRVDARAKVTGQAKYTQDLMTQPMMVAKVVHSTIANGVVTGFDLDEALKVPGV
IKIVTCFDVPEIDFCTPGHPWSVEAAHQDVQDRRLLNQRVRYYGDDVAAVIAEDEIAAVK
AARLVKVHYEEYPALVDVADAMAEGAVAMHDNVPDNILKHTSFALGDESFDEAVKEKGLI
LVDQTYDTQRVQHCHIELPVSFAYQDGNGKITVTTSTQIPHIVRRVIGQALGIPWGQVRV
IKPYIGGGFGNKQDVLYEPLNAFLSLQVGGRPVKLELTREETFADTRVRHAIRFHMQGAV
RPDGTLVARRVEAFSNQGGYASHGHAIVANASNMIKQLYRDEKALESESYTVYTSTVAGG
AMRGYGIPQGDFAAECLMDDLAAAIHMDPLAFRLKNCMEEGYKDPHNGITFYSYGLKKCI
EAGKEAVHWDEKRAAYACQTGSRRRGIGMAIFCYKTGVYPISLETATCRMVLNQDGSIQL
MMGATEIGQGADTVFTQMAAEVLGVTEDKVYIVSTQDTDVTPFDTGAYASRQSYVSGKAV
KKTAEMMKEKILEYAAWKLKMDQQTLDIRNNMIVTAEGEELLTMEALATEALYSLERSVH
ITAEATSHCKENTFASGACFAEVEVDMPLGKVNVLKIINVHDSGILMNPKLAEAQVHGGM
SMGLGYGLSEELMYDAKGKPLNNNLLDYKLPTAMDTPELNVEFIELQDPTGPFGNKALGE
PPAIPVAPAIRNAVLQATGIGFNQLPMEPQRLVAAFKEKGLI
NT seq 2289 nt   +upstreamnt  +downstreamnt
atggggattggaaaaagcattcagcgtgtggatgcccgtgccaaggtaacgggccaggcg
aaatatacacaggatctgatgacacagccgatgatggtggcgaaggtggtacacagtacc
attgccaatggtgttgtgactggatttgatttggatgaggcattaaaagtaccgggggtt
ataaagattgttacctgttttgatgtgccggagattgatttttgtacgccggggcatccg
tggtctgtggaggcggcgcatcaggatgttcaggacaggcgtcttttgaatcagcgggtg
cgttattatggggatgatgtggcagctgtcattgcagaagatgagattgcagctgttaag
gcagcacgacttgtgaaagtacattatgaggaatacccggcactggtggatgtggcagat
gccatggcggagggagccgtggctatgcatgacaatgtgccggataatattttgaaacat
acatctttcgccctgggtgatgaaagctttgatgaagctgtgaaagaaaagggacttatt
ctggtggatcagacgtatgatacccagcgtgtacagcattgtcatattgaactgccggtt
tcctttgcgtatcaggacggcaacggcaagattaccgtaaccacatctacacagattccg
catattgttcgccgtgtcattggacaggcccttggtattccatggggacaggtcagagtg
atcaagccgtatatcggcggcggcttcggcaataaacaggatgtgctttatgaaccgctg
aatgccttcttaagtctgcaggtgggcggtcgtccggtgaaactggagctgaccagagaa
gaaacatttgcggatacaagagtgcgtcatgcgatccgttttcatatgcagggagctgta
agaccggacggtacactggtggccagaagagtagaagctttttctaatcagggcggttat
gcttcccatggccatgcgattgtcgccaatgcctccaatatgatcaagcagctttatcgg
gatgaaaaggcccttgaatcggaaagctacacggtttacaccagtacagtggccggcggc
gccatgcgtggttacggtattccacagggagattttgcagcagagtgtctgatggatgat
ctggcggcagccattcatatggatccattagcctttcgtttgaaaaactgtatggaagag
ggatataaggatccgcataacggtattacattttacagctatggcctgaagaaatgtatt
gaagcgggcaaagaggctgtgcattgggatgaaaagcgagccgcttatgcctgccagaca
ggcagcagacgccgcggcatcggtatggcgattttctgctacaaaaccggcgtttatccg
atttctcttgaaactgccacatgccgtatggtattgaatcaggacggttccattcagttg
atgatgggagccacagagatcggacagggagcggataccgtctttacacagatggcggca
gaggtacttggcgtgacagaggacaaagtgtatattgtttccacccaggacacagatgtc
acaccttttgataccggggcttatgcttccagacagtcttatgtcagcggcaaggctgtg
aagaaaacagcagagatgatgaaggaaaagattcttgaatatgcagcctggaaattgaag
atggatcagcagacactggatatccgcaataatatgattgtgacagcagagggcgaagaa
ctgctgacaatggaggcactggcgacagaggcattgtacagtctggaacgttctgtccat
atcactgctgaggccaccagccactgcaaagagaatacatttgccagcggtgcctgtttt
gcggaagtggaagtggatatgccgttaggcaaagtcaatgtactgaagattatcaatgtc
catgacagcggtattctgatgaatccaaaactggctgaggcccaggtgcatggcggtatg
agcatgggccttggttatggactcagtgaagaattaatgtatgatgcgaagggcaaaccg
ctgaacaacaatcttctggattacaagctgccgacggccatggatacaccggagctgaat
gttgagtttatagaattgcaggatccgacaggacctttcggcaacaaagccctgggagaa
ccaccggctattccggtggcaccggctatccgaaacgcagttttgcaggcaacaggcatt
ggctttaatcagcttccgatggagcctcagagactggtggcagcattcaaagaaaaagga
ctgatatag

DBGET integrated database retrieval system