KEGG   Coprococcus catus: CC1_32780Help
Entry
CC1_32780         CDS       T02584                                 

Definition
(GenBank) siroheme synthase, N-terminal domain
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
cct  Coprococcus catus
Pathway
cct00860  Porphyrin and chlorophyll metabolism
cct01100  Metabolic pathways
cct01110  Biosynthesis of secondary metabolites
cct01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cct00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CC1_32780
Enzymes [BR:cct01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     CC1_32780
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     CC1_32780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M TrkA_N Shikimate_DH AlaDh_PNT_C NACHT
Motif
Other DBs
NCBI-ProteinID: CBK81817
UniProt: D4JBU6
Position
3325515..3326180
Genome map
AA seq 221 aa AA seqDB search
MADFPLFIKMDGRKVMVIGGGSVALRKIRILMDYGADIRIISGEVRDELKMLAEAGRLEW
QKENLTKKHLSELDEAFLVICASNDETVNVMAANYCQRRHILVDCAKPGENSDFVFPSVV
RRGNVVIGISTSGGVPALTRYLREKIEALIPEWYGELEIELCQKRRELKMSGLGQSDRKK
YLRQWIAEEEKIREKGREPYENRNEEEPSGHGADGNGGGGH
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggctgattttccgttgtttatcaaaatggatggccgaaaagtcatggtcatcggcggc
ggttcggtggcgcttcggaagatacggattttaatggattacggtgcagatatcaggatt
atttcgggagaagtacgggatgaattaaagatgctggctgaggcgggcaggcttgaatgg
cagaaagaaaatctgacgaaaaagcacctgtctgagttggatgaagcttttctcgtgatc
tgtgcatcgaatgatgagacggtgaatgtgatggcagccaattattgtcagagacgccat
atactggtggattgtgccaaaccgggagaaaattcggactttgtgtttccatcggtggtc
agacggggcaatgtggtcattggtatcagtacatccggcggtgtgcctgcactgaccaga
tatttgcgggagaaaatcgaagcattgataccggaatggtacggtgaactggaaatagag
ctttgccagaagcgcagagagttgaaaatgtccgggctcggtcagtcagacagaaaaaaa
tatctgagacagtggattgccgaagaagagaaaataagagagaagggcagggaaccgtat
gaaaatcggaacgaggaagagccgtctggccatggtgcagacggaaatggcggcggaggc
cattaa

DBGET integrated database retrieval system