KEGG   Cryptobacterium curtum: Ccur_01930Help
Entry
Ccur_01930        CDS       T00962                                 

Definition
(GenBank) N-dimethylarginine dimethylaminohydrolase
  KO
K00613  glycine amidinotransferase [EC:2.1.4.1]
Organism
ccu  Cryptobacterium curtum
Pathway
ccu00260  Glycine, serine and threonine metabolism
ccu00330  Arginine and proline metabolism
ccu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ccur_01930
   00330 Arginine and proline metabolism
    Ccur_01930
Enzymes [BR:ccu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.4  Amidinotransferases
    2.1.4.1  glycine amidinotransferase
     Ccur_01930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidinotransf
Motif
Other DBs
NCBI-ProteinID: ACU93924
UniProt: C7MLY4
Position
236363..237511
Genome map
AA seq 382 aa AA seqDB search
MAKIVSSWNDWDPLKRVIVGRCDNSMIPPEEPATSEKVPVDSAMRGMWGPRPLETVERGN
ECLENLVKVLEDHGVIVDRPTPLQWNQAIGTPDFRNDSMMTCMPPRDILLTVGPEIMAAA
NSFRCRYFEYLAYWPLMEQYFEEDPEFLWTQAPRPRLTDKSYKHNYYDESISLEERLKRT
AAKDFVTTEVEPMWDAADVMRMGKDLFIQHGLTTNRAAMEWFQRYYRDFRVHAVNFPGDP
YPIHIDATFVPLRPGLIINNPVRPLPEEQRAIFDANDWQIVDAAQPAHTEPPALCYSSVW
LSMNCLVLDPKTVIVEASEVHQLEQMDKLGMNVIPCDLRDAYPFGGGLHCSTADVYREGD
CLDYFPNRVKDPTLVRPELWND
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatcgtaagttcatggaatgattgggatccgcttaagcgcgttatcgtgggg
cgttgtgacaactcaatgattccacccgaagaacccgcgacatctgaaaaggtgccggta
gattctgccatgcgtggcatgtggggacctcgtccgcttgaaacggtggaacgtggcaat
gagtgtctcgagaacttggtgaaggttcttgaggatcatggcgttattgttgatcgtcct
acgccgttgcagtggaaccaggccatcggcactcctgacttccgtaacgattcaatgatg
acatgcatgccgccacgcgacatattgttgactgtggggcctgaaattatggcggctgcc
aatagttttcggtgccgttacttcgagtatttggcctactggccacttatggaacagtat
ttcgaagaggatcctgagtttctgtggactcaagcgccacgtccacgcttgaccgataag
tcgtacaagcacaactattacgatgagtccatcagcctggaagagcgtcttaagcgcacc
gccgcaaaggatttcgtaaccactgaagttgagccgatgtgggatgctgctgatgttatg
cgcatgggcaaggacctgtttattcagcatggtcttaccacgaatcgtgcggctatggaa
tggttccagcgctattatcgcgactttcgcgtgcatgcggtgaacttcccaggcgacccg
tatcctattcatatcgatgcgacgttcgtaccgctgcgtccaggtcttattatcaacaat
ccggttcgtccgctacctgaagaacagcgtgcgatcttcgatgcaaacgattggcaaatt
gttgatgcggcgcaaccggcgcacacagagccgccggcactttgctacagctcggtgtgg
ctgtctatgaattgcctcgtgctcgatccgaagaccgttattgttgaggcatctgaggtt
catcagcttgaacagatggataagcttggcatgaacgttattccgtgtgatctgcgcgac
gcgtatccattcggtggtggcctacactgctcgactgctgacgtttatcgtgaaggcgac
tgcttggattacttccccaatcgggtgaaggaccccacgcttgtacgtcccgagttgtgg
aatgactag

DBGET integrated database retrieval system