KEGG   Cryptobacterium curtum: Ccur_10410Help
Entry
Ccur_10410        CDS       T00962                                 

Definition
(GenBank) CDP-glucose 4,6-dehydratase
  KO
K01709  CDP-glucose 4,6-dehydratase [EC:4.2.1.45]
Organism
ccu  Cryptobacterium curtum
Pathway
ccu00520  Amino sugar and nucleotide sugar metabolism
ccu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ccur_10410
Enzymes [BR:ccu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.45  CDP-glucose 4,6-dehydratase
     Ccur_10410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD RmlD_sub_bind NAD_binding_4 adh_short
Motif
Other DBs
NCBI-ProteinID: ACU94732
UniProt: C7MP92
Position
1182254..1183441
Genome map
AA seq 395 aa AA seqDB search
MEDLVKDTGALRPSVQTPHERTIEGSTDTTDAPLQPRLGELQFYRGKRVFITGHTGFKGS
WLCRMLVHAGATVHGYALTPDDTFSLFTIANIGQDIESTFGDIRDVSALERAFNRAQPDI
VIHLAAQPLVRESYQHPRETYEINVMGTVNVMECARKTGNVQSILNVTTDKVYRDNGNIQ
VFSEEDFLDGADPYSNSKSCSELVTHCYQRSFLSSAGAALSTARAGNVIGGGDFARDRLV
PDCVRAVLADRPIVIRNPRSVRPFQHVLESLGAYLMIARAQYDDAALAGWYNVGPRYEDC
LSAGALADEFCTCWGESARWEHHGDNGPYEAARLQLDSTLIRKTFGWHPVWDVHEAIYRT
VEWTRAWIDEKRASDCLDEQIERWCATARRGELDV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaagatctggtaaaagacactggtgcgctgcgaccttctgttcagacacctcatgag
cgcaccatagaaggttcgacagataccaccgatgcgccacttcagccgcgccttggtgag
cttcagttttatcgcggaaagcgtgtgttcattacaggacataccggctttaaagggtcg
tggctctgccgcatgctcgtgcacgctggcgcaacagtacacggttatgctcttactccc
gatgatactttcagtctttttaccattgccaatatcggccaagacattgaatcaacgttc
ggcgatatacgcgacgtttcagcacttgagcgggcgtttaaccgtgcgcaacctgacatc
gtgattcacttggctgcacagccgctcgtacgtgaaagttatcagcacccgcgcgaaacc
tacgaaatcaatgtcatgggtaccgtcaacgttatggaatgcgcacggaagacgggaaat
gttcagtcgattcttaatgtcaccaccgacaaggtgtatcgcgacaatgggaacatacag
gttttttcggaagaggacttccttgatggagctgatccgtattccaattcaaagtcgtgt
tcagaactagttactcactgctaccagcgcagctttctttcgtcagcaggcgcagcactg
agcaccgcacgggctggtaacgttatcggcgggggcgacttcgcacgcgatcgcttggta
cctgactgcgtacgtgccgtcttggctgatagacctattgttattcgcaatcctcgatcg
gtgcgaccctttcagcatgtgctggaatcactaggtgcctatctgatgattgcacgcgcc
cagtacgatgatgccgcattggctggctggtataacgtgggaccgcgctacgaagactgc
ctcagtgccggtgctcttgctgatgaattttgtacctgctggggcgaatcggcgcgctgg
gaacatcacggcgataatggtccgtatgaagcagcacgtcttcagttagacagcaccctt
attcgcaaaacatttggctggcatccggtgtgggatgtgcacgaggcgatatatcgcacc
gtggaatggacacgcgcttggattgacgaaaaacgggcaagcgactgcttagacgagcag
atagaacgctggtgcgcaacagctcgaagaggagaactggatgtttga

DBGET integrated database retrieval system