KEGG   Cryptobacterium curtum: Ccur_12360Help
Entry
Ccur_12360        CDS       T00962                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
ccu  Cryptobacterium curtum
Pathway
ccu00860  Porphyrin and chlorophyll metabolism
ccu01100  Metabolic pathways
ccu01110  Biosynthesis of secondary metabolites
ccu01120  Microbial metabolism in diverse environments
Module
ccu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ccu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ccur_12360
Enzymes [BR:ccu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Ccur_12360
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Ccur_12360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: ACU94920
UniProt: C7MKX3
Position
complement(1403564..1405303)
Genome map
AA seq 579 aa AA seqDB search
MSECLGATVYLVGAGPGDPGLLTVRAKELLECADVVIYDYLASSAVMHFVNPAAQRIFVG
KKGFSDHVTQEEINQCLIAVAQQYETAQQYGATQQGAATYPGKGVSHDKTAQQDEISQLD
KAAAQDQATRQDHHAIIVRLKGGDPFVFGRGGEEALALVDAGIPFEVVPGITAGVAAATY
AGIPVTHRTQASSVTLITGHETPDKEAPTIDWEHLAQGSDTLCFYMGIRDLPLISQRLIE
HGRPADTPVALVRWGTTPKQEVLTATLDSVAQAAEEAGFQAPAIIVVGEVVSLRDKLSWF
DNRPLSGQSIVVTRSREQASVLSSGLSTLGAQVVEFPTIAIKPRSIDAHIRSALMRLASD
AAHVRESYDWVVFTSANGVQCFFAALNELHLDARSLGGVKVAAIGPATAAELHNQGISPD
VVPEKFIAESVAQALVESGVGRGTRVLLPRAAVARDALPNRLTQAGAQVEVLPLYDTVIP
HAEVAAQDLATSLRAGEVSAITFTSSSTVRNFKEMLAAVMPESELIHLLETVTCASIGPV
TSDTMRDLTIPVSVQADTHTIPGLISALQTALDKEEQLK
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgagtgtttaggcgccacggtgtatttggttggggctggaccgggagatccaggt
ttgctgacggtgcgcgcgaaagagctgcttgagtgcgctgatgtggttatctacgactat
ctggcgagcagtgctgtcatgcactttgtcaatccggctgctcagcggatatttgtgggc
aagaagggtttttctgaccatgttacgcaagaagagattaaccagtgtcttattgcagta
gcccaacagtatgaaacggcccaacagtatggagcaacacagcaaggtgcggcaacttac
cctggcaagggagtctcgcatgacaaaacagcgcagcaagatgaaataagccagctagat
aaggcggcagcgcaggatcaagcaacccgtcaagaccatcatgcgattattgtgcgcctg
aaaggcggcgatccatttgtattcggtcggggtggtgaagaagcacttgccctcgtggat
gctggtattccgtttgaagtagtgcctggcataacggccggggtggctgcagctacctat
gcgggtattcccgtgacacatcgcacacaggcaagttcagtaacactgatcacggggcat
gagactcccgataaagaagcaccaactatcgattgggagcatctggcacagggcagcgac
accctttgcttttacatgggtattcgcgacttaccattgatttcacagcggctgatagaa
catggccgtcctgcggatacgccggttgcgcttgtgcgatgggggacaacaccaaagcaa
gaggtgcttactgcaacgttggatagtgttgcacaggcggcagaagaagcaggctttcag
gcgccagccattattgtagtgggcgaggttgtttcgctgcgcgataagctgtcctggttt
gataaccgcccgctttcgggacagtccattgttgttacgcgcagtcgcgaacaggcgagt
gtcctttcaagtggtctttcaacgctgggcgcgcaggtggtggagtttccaaccattgcc
atcaagccgcgttccattgatgcacacatacggtcagccctcatgcgcctggcaagcgat
gcggcccatgtacgtgagtcgtacgattgggtggtgtttaccagcgccaatggtgtgcag
tgcttctttgctgcgcttaatgaattacatcttgatgctcgttcgcttggcggcgtaaag
gtagcagcaattggccccgcaacagccgctgagctgcataatcaggggatatcacccgat
gtcgtacctgaaaagtttattgctgaatcagttgcgcaggcgctcgttgaatccggcgtt
ggtcggggtacgcgtgttttactaccgcgcgctgcggttgcgcgtgatgccctacccaat
cgattgacgcaggctggtgcacaagttgaggtactgccgctctatgacacggttattccc
catgctgaagtggcagcgcaggatcttgcgacgtcccttcgtgctggtgaagtgtcggct
atcacctttacgtcgtcatcaaccgtgcgcaattttaaggaaatgcttgcagcggttatg
ccggaaagtgaattaattcatctgcttgaaacggtaacctgtgcgagcatcggaccggtg
acgagcgataccatgcgcgatctgacaattcccgtttctgtgcaggcagatacccatacg
attcccgggttaataagcgctttgcagacagcgcttgataaggaggagcaactgaaatga

DBGET integrated database retrieval system