KEGG   Campylobacter cuniculorum: CCUN_0041Help
Entry
CCUN_0041         CDS       T05046                                 

Gene name
metA
Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
ccun  Campylobacter cuniculorum
Pathway
ccun00270  Cysteine and methionine metabolism
ccun00920  Sulfur metabolism
ccun01100  Metabolic pathways
ccun01110  Biosynthesis of secondary metabolites
ccun01130  Biosynthesis of antibiotics
ccun01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccun00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CCUN_0041 (metA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CCUN_0041 (metA)
Enzymes [BR:ccun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     CCUN_0041 (metA)
    2.3.1.46  homoserine O-succinyltransferase
     CCUN_0041 (metA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: ARJ55711
UniProt: A0A1W6BUG8
Position
complement(33525..34403)
Genome map
AA seq 292 aa AA seqDB search
MPLVIPKEIPAFDILKNSVFVMDTQRANSQDIRALEILILNLMPTKIETENQLLSLLANS
PLQIHISFIATQSYVGKNTPLTHMEKFYQGVNEIKNKKFDGAIVTGAPVELMNFEDVKYW
EELKQIFDFLRENVTSTMYLCWGAMGALYYFYGIEKYALDKKCFGVFSHTIKNQDLILTN
LNERVLMPHSRHSHINEAQILNHKELKILLENDEAGISMLRDKQDIFILGHLEYFKNTLN
LEYERDAKIQAPKNYFDEKGEIAYNWRSNANTIFSNWLNYDVYQSTPYVLSF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgccattagttataccaaaagaaattccagcttttgacatactcaaaaatagtgttttt
gttatggatacacaaagagcaaattctcaagatataagagcacttgaaattttaatcctc
aatctcatgccaaccaaaattgaaacagaaaatcaactcttatctcttttggcaaattct
cctttgcaaattcatatcagttttattgcgactcaaagttatgttggcaaaaacacgcct
ttgactcatatggaaaaattctatcaaggtgtcaatgagattaaaaacaaaaaatttgac
ggagccatcgttacgggtgctcctgtcgaacttatgaattttgaagatgttaagtattgg
gaagaattaaagcaaatttttgattttttacgcgaaaatgttacaagcacaatgtatctt
tgctggggtgcaatgggagcactttattatttttatgggattgaaaaatatgctttggat
aaaaaatgctttggagttttttctcatacaatcaaaaatcaagaccttatcctcacaaat
ttaaatgaaagagttttaatgcctcattcaagacacagccatatcaatgaagctcaaatt
ttaaatcataaagaattaaaaattttgcttgaaaatgatgaagcgggcatttcaatgcta
agagacaaacaagatatatttatcttagggcatttagaatatttcaaaaacactctaaac
cttgaatacgaaagagatgcaaagattcaagctccaaaaaattattttgatgaaaaaggt
gagattgcatacaattggcgttcaaatgcaaatacgattttctcaaattggctcaattat
gatgtgtatcaaagcacaccttatgtgttgagtttttag

DBGET integrated database retrieval system