KEGG   Campylobacter cuniculorum: CCUN_0162Help
Entry
CCUN_0162         CDS       T05046                                 

Gene name
gatC
Definition
(GenBank) Glu-tRNA(Gln) amidotransferase, subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
ccun  Campylobacter cuniculorum
Pathway
ccun00970  Aminoacyl-tRNA biosynthesis
ccun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccun00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CCUN_0162 (gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ccun03029]
    CCUN_0162 (gatC)
Enzymes [BR:ccun01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CCUN_0162 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CCUN_0162 (gatC)
Mitochondrial biogenesis [BR:ccun03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CCUN_0162 (gatC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln PIP5K DUF4089
Motif
Other DBs
NCBI-ProteinID: ARJ55821
UniProt: A0A1W6BUS6
Position
complement(159553..159840)
Genome map
AA seq 95 aa AA seqDB search
MQIDEKLLSKLEKLSALKINDEKRNELVNQLSEIVNFVEKLNELDLSSLQATINTIEGGT
PFRKDEVKSSEVIDEILKNAPKTNGHFFAVPKIIE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattgatgagaaattattaagcaaacttgaaaaattaagtgctttaaaaatcaat
gatgaaaaaagaaatgagcttgttaatcaattgagcgaaatcgtcaattttgttgaaaaa
cttaatgagcttgatttaagttcattgcaagctacaatcaatacaatcgaagggggaaca
ccttttagaaaagatgaggttaaaagtagcgaagttattgatgaaattttaaaaaatgct
ccaaaaactaatgggcatttttttgcggtgccaaagattatagagtga

DBGET integrated database retrieval system